• 专利附录
  • 专利说明
  • 权利要求
  • 类似技术
  • 同族专利
  • 引用文献
  • 法律状态
  • 优先权
    • 专利摘要:
    The invention relates to cationic complexes formed of a lanthanide ion Ln3 + and a ligand of formula (I): with X, Y and R1 as defined in claim 1, and their salts with an anion, their solvates and hydrates ; with the exception of the cationic complexes formed of a lanthanide ion Ln3 + and a ligand corresponding to one of the formulas (I.1) to (I.5) as defined in claim 1, and their salts, solvates and hydrates. The subject of the invention is also the use of such a complex or of a cationic complex formed of a lanthanide ion Ln3 + and a ligand of formula (I.1) to (I.5) as defined at claim 1, or a salt thereof with an anion, their solvates or hydrates, as an aid to the crystallization of a biological macromolecule, as well as crystallization processes, methods of analysis or determination of the structure of a biological macromolecule.
    公开号:FR3045606A1
    申请号:FR1562880
    申请日:2015-12-18
    公开日:2017-06-23
    发明作者:Olivier Maury；Eric Girard；Sylvain Engilberg；Francois Riobe
    申请人:Centre National de la Recherche Scientifique CNRS；Universite Claude Bernard Lyon 1 UCBL；Commissariat a lEnergie Atomique CEA；Ecole Normale Superieure de Lyon；Commissariat a lEnergie Atomique et aux Energies Alternatives CEA；
    IPC主号:
    专利说明:

    In ='Eu, Yb, (et Gd poour HPD03A)
    Il existe dans la littérature quelques agents phasants luminescents, comme des dérivés fonctionnels du DPA3 (FR 2 991 322 et ACIE 2008) ou des complexes de lanthanide directement greffés à la structure des protéines (X. C. Su, H. B. Liang, K. V. Loscha and G. Otting, 3. Am. Chem. Soc., 2009,131, 10352-10353).
    Parmi tous ces dérivés, les complexes tri-anioniques [(DPÂ)3Ln]3~ semblaient très prometteurs car des interactions spécifiques avec des acides aminés cationiques et en particulier, avec l'arginine ont été mises en évidence par certains des inventeurs de la présente demande de brevet (E. Dumont, G. Pompidor, A. D’Aléo, J. Vicat, L. Toupet, R. Kahn, E. Girard, O. Maury, N. Giraud, PhysChemChemPhys 2013, 15, 18235-18242), et confirmées par des mesures de RMN (X. C. Su, H. B. Liang, K, V. Loscha, G. Otting, J. Am. Chem. Soc., 2009, 131, 10352-10353). Malheureusement, ce composé s'est avéré instable dans un grand nombre de formulation composant les kits de cristallisation commerciaux : (î) la présence de métaux de transition (Zn(II), Cu(II), Fe(II)) induit la déstructuration du complexe, (il) la présence de sels alcali no-terreux divalents (Ba(II), Ca(II), Mg(II)) provoque l'auto-cristallisation immédiate du complexe donnant lieu à une détection de faux-positifs (cristaux de complexes et non de cristaux dérivés de protéines) (Thèse de doctorat de R. Talon soutenue à Grenoble le 6 Juin 2012). D'autres solutions ont proposé d'introduire des lanthanides dans les cristaux de protéines, pour obtenir un effet phasant Nagem et al. (Nagem, R. A., Dauter, Z. & Polikarpov I, Acta Crystallogr. D, 2001, D57, 996-1002) ont proposé d'utiliser les sels de lanthanide et la méthode du trempage rapide (Dauter Z., Dauter, M. & Rajashankar, K. R. Acta Crystallogr. D, 2000, D56, 232-237). Cette méthode développée initialement pour les sels d'halogénure (NaCl, Nal, NaBr) consiste à tremper, pendant un temps inférieur à la minute, les cristaux dans une solution saline très concentrée (> 1 mol L1). Dans le cas du sel de lanthanide, cette méthode a conduit à une dégradation rapide des cristaux. Purdy et al. (Purdy M. D., Ge P,, Chen J., Selvîn P. R., & Wiener, M. C. Acta Crystallogr. D, 2002, D58, 1111-1117) ont proposé d'utiliser une liaison covalente reliant des complexes de lanthanide (où ie ligand assure une coordination complète du lanthanide) à la protéine. La liaison est constituée par un pont disulfure formé entre des cystéines libres de la protéine et une fonction réactive thiol portée par le complexe. Enfin, Silvaggi et al. (Silvaggi, N. R,, Martin, L. J., Schwalbe, H., Impérial), B., Allen, K. N. J., Am. Chem. Soc., 2007 129, 7114-7120) ont proposé l'utilisation d'un « tag » fixant un ou deux lanthanides (LBT pour Lanthanide-Binding Tag). Le LBT est fondé sur une séquence peptidique dérivée des boudes' à calcium qui peut être introduite dans les protéines par les techniques de biologie moléculaire classiques (Allen, K. N. Imperiali B., Current Opinion in Chemical Biology, 2010,14, 247-254).
    Il existe donc un besoin de disposer de nouveaux agents phasants qui ne nécessitent pas de modifier la structure des macromolécules biologiques, dont on souhaite déterminer la structure. De manière additionnelle, l'invention se propose de fournir des agents phasants qui soient suffisamment stables dans la plupart des conditions de cristallisation des macromolécules biologiques et qui permettent également d'élargir les possibilités d'obtention de cristaux permettant d'obtenir des informations structurales sur la macromolécule biologique d'intérêt
    Dans ce contexte, l'invention concerne des complexes cationiques formés d'un ion lanthanide ln3+ et d'un ligand de formule (I) :
    dans laquelle. : - X et Y, identiques ou différents, représentent, chacun indépendamment, -CHr(CH2)n-, -CH2-CCH2)n"A-CH2CH2» ou -CH2-CR3RVCH2-, X se lisant sur la formule générale (I) de la gauche vers la droite et Y se lisant sur la formule générale (I) de la droite vers la gauche, avec : ο n qui est égal à 1, 2 ou 3 ; o A qui représente -NR2-, -0(CH2)20- ou -O-, avec R2 qui est un atome d'hydrogène ou un groupe méthyle ou -CH2R5, Rs représentant un groupe phényle, pyridinyle ou picolinyle ; o Rs qui représente un groupe méthyle ; et o R'4 qui représente -NHR* avec R4 qui représente -H, -CH3, -CH2R6 ; Re représentant un groupe phényle ou pyridinyle ; - Ri représente :
    avec : o R7 qui représente -COO , -COIMH2, -C0NHR9, -PR900, ou un groupe choisi parmi :
    avec R9 qui représente un atome d'hydrogène, un groupe méthyle, éthyle ou phényle ; et α *8 qui représente un atome d'hydrogène, de fluor, chlore, brome ou iode, un groupe -OH ou -NH2 ; étant entendu qu'au moins un des enchaînements X et Y est différent de -CHz-ÎCHzV-, et leurs sels avec un anion, leurs solvats et hydrates ; à l'exception des complexes cationiques formés d'un ion lanthanide Ln3+ et d'un ligand répondant à l'une des formules (U) à (1.5) suivantes, et de leurs sels avec un anion, leurs solvats et hydrates :
    Les ligands de formule (I) comprennent au moins 7 sites de coordination pour un ion lanthanide Ln3+, voire plus, en fonction des structures de X et Y. Ces sites de coordination se trouvent sur les deux atomes d'azote représentés sur la formule (I), sur les deux pyridines des groupements Ri, sur les deux groupes R7, au moins un site de coordination se trouvant sur X et/ou Y.
    Les complexes selon l'invention, ainsi que les complexes de lanthanide formés avec les ligands de formules (1.1) à (1.5), sont cationiques et présentent une charge positive supérieure ou égale à 1. Ils comportent un ligand macrocydique incorporant plusieurs groupements aromatiques formant une sphère de coordination ouverte pour l'ion lanthanide. Ces groupes aromatiques, lorsque l'ion ln3+ est Eu3+ ou ïb3+, agissent également comme antennes pour sensibiliser la luminescence du lanthanide dans le visible.
    Par ailleurs, les complexes selon l'invention, présentent l'avantage d'être solubles dans l'eau et stables dans la plupart des milieux de cristallisation commerciaux. Dans le cadre de l'invention, il a été démontré que ces complexes présentaient un intérêt, non seulement en tant qu'agent phasant, lors de l'obtention de données structurales, mais également en tant qu'aide à la cristallisation. En particulier, ledit complexe est utilisé en tant qu'agent nucléant et/ou en tant qu'agent cristallisant lors de la cristallisation d'une macromolécule biologique. De telles applications n'avaient jamais été décrites ou envisagées pour les complexes de lanthanide formés avec les ligands de formules (1.1) à (1.5) déjà décrits dans la littérature (M. Mato-Iglesias et al., Inorg. Chem. 2008, 47, 7840-7851 ; Z. Palinkas et al., Inorg. Chem. 2009, 48, 8878-8889 ; A. Roca-Sabio et al., Dalton Trans, 2011, 40, 384-392 et M. Regueiro-Figueroa et a!., Inorg. Chem. 2015, 54, 4940-4952 pour les complexes des ligands (1.1) à (1.3) et A. Rodrigues-Rodrigues et ai., Inorg. Chem. 2012, 51, 2509-2521, pour les complexes des ligands (1.4) et (1.5)). En effet, ces complexes ont été préparés pour des études fondamentales de chimie de coordination des lanthanides (étude de la stabilité des complexes formés avec différents lanthanides) et dans le cas du Gd, seules des applications en tant qu'agent de contraste IRM ont été envisagées.
    De manière avantageuse, les complexes selon l'invention, ainsi que leurs seis avec un anion, leurs solvats et hydrates, sont formés avec un ligand répondant à l'une des formules suivantes :
    avec Ri, R2, n et R4 qui sont tels que définis pour la formule (I). A titre d'exemple de sels, des complexes selon l'invention ou des complexes formés avec l'un des ligands (1.1) à (1.5) qui trouvent application dans le cadre de l'invention, on peut citer les sels d'un complexe cationique avec un anion (ou plusieurs anions, en fonction de la charge du complexe) choisi parmi : CI', Br", Γ, OH', N03", trîflate, PFe', SbFs', B(Ph)4', BF4~, les sulfates, sulfonates, carbonates, phosphates, phosphonates et carboxylates. Les sulfates et sulfonates pourront correspondre à S042', HSO3' ou R'S03', les carbonates à CO32", HCO2" ou R'C02.", les phosphates et phosphonates à ROP03Z" et R'P032" et les carbonates à R'CCL", avec R' qui peut être, notamment, un groupe alkyle ou aryle, notamment un groupe alkyle comprenant de 1 à 4 atomes de carbone ou un groupe phényle. Sous 1a. forme de sels, les complexes, selon l'invention, pourront également se trouver sous la forme d'hydrate ou solvats, c'est-à-dire avec au moins une molécule d'eau.ou de solvant dans la sphère de coordination du lantbanide.
    De manière préférée, les complexes selon l'invention, ainsi que leurs sels avec un anion, leurs solvats et hydrates, sont formés avec un ligand répondant à la formule (IA) ;
    dans laquelle η—1 et R2=H, et Ri est tel que défini pour les composés de formule (I).
    De manière avantageuse, dans les ligands de formule (I), (IA) à (IF), Ri représente :
    avec : - R7 qui représente -COO' ou -PRgOO’ avec R9 qui représente un groupe méthyle ou éthyle ; ou bien R qui représente un groupe:
    - Rs qui représente un atome d'hydrogène, de fluor, chlore, brome ou iode.
    Dans le cadre de l'invention, lorsqu'un substituant représente un groupe pîcolinyle, il représente :
    De manière préférée, les complexes selon l'invention sont choisis parmi les complexes de formule :
    ainsi que leurs sels avec un anion, en particulier, leur sel chlorhydrate, leurs solvats et hydrates.
    De manière avantageuse, les complexes selon ('invention ou les complexes formés avec l'un des ligands (1.1) à (1.5) qui trouvent application dans ie cadre de l'invention, ainsi que leurs sels avec un anion, en particulier leur sel chlorhydrate, leurs solvats et hydrates, sont formés avec un ion lanthanide Ln3+, Ln étant Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb ou Lu, avec Eu, Tb, Yb et Lu qui sont préférés. L'invention a également pour objet l'utilisation d'un complexe selon l'invention, ou d'un complexe cationique formé d'un ion lanthanide Ln3+ et d'un ligand de formules (1.1) à (1.5) telle que précédemment définie, ou d'un de leurs sels avec un anion, leurs solvats ou hydrates, en tant qu'aide à la cristallisation d'une macromolécule biologique. En particulier, ledit complexe est utilisé en tant qu'agent nucléant et/ou en tant qu'agent cristallisant lors de la cristallisation d'une macromolécule biologique.
    Tous les complexes de lanthanide selon l'invention, ou formés avec un ligand de formule (II) à (1.5), présentent un intérêt pour leur effet nucléant ou cristallisant. Cependant, seuls les complexes de terbium ou d'europium présenteront des propriétés de luminescence'dans te visible. Aussi, si dans le complexe, Ln =Eu ou Tb, le complexe pourra également être utilisé en tant qu'agent luminescent pour la détection de cristaux. L'invention a également pour objet l'utilisation d'un complexe selon l'invention, ou d'un complexe cationique formé d'un ion lanthanide Ln3+ et d'un ligand de formule (1.1) à (1.5) telle que précédemment définie, ou d'un de leurs sels avec un anion, leurs solvats ou hydrates, en tant qu'aide à l'obtention de données structurales d'une macromolécule biologique. En particulier, ledit complexe est utilisé en tant qu'agent phasant lors de la détermination structurale par diffraction des rayons X. Là encore, si dans le complexe, Ln =Eu ou Tb, le complexe pourra également être utilisé en tant qu'aide au positionnement du cristal dans un faisceau de rayons X.
    En particulier, dans le cadre de l'invention, par « macromoiécule biologique », on ' entend en particulier les peptides (enchaînement de moins de 100 acides aminés), les protéines (enchaînement d'au moins 100 acides aminés) et les acides "nucléiques, notamment les ADN ou ARN. De telles macromolécules biologiques présenteront notamment une masse moléculaire moyenne supérieure à 1 kDa. L'invention a également pour objet les'cristaux dérivés d'une macromolécule biologique comprenant un complexe selon l'invention ou' un complexe cationique formé d'un ion lanthanide Lm3+ et d'un ligand de formule (1.1) à (1.5) telle que précédemment définie, ou un de ses sels avec un anion, soîvat ou hydrate. L'invention a également pour objet un procédé de cristallisation d'une macromolécule biologique, de préférence choisie parmi les peptides, les protéines et les acides nucléiques, notamment les ADN ou ARN, comprenant les étapes suivantes : - disposer d'une solution comprenant ladite macromolécule biologique et un complexe selon l'invention, ou un complexe cationique formé d'un ion lanthanide Ln3+ et d'un ligand de formule (1.1) à (1.5) telle que précédemment définie, ou un de ses sels avec un anion, solvat ou hydrate, - obtenir des cristaux de la macro molécule à partir de ladite solution.
    La solution utilisée pourra comprendre, en outre, un agent précipitant, autre que le complexe, notamment choisi parmi ceux utilisés dans les kits de cristallisation commerciaux, en particulier parmi ceux présents dans les tableaux présentés en Annexes 2A ou 2B, comme par exemple, les sels tels que les sels d'ammonium, les sulfates (notamment le sulfate d'ammonium), acétates, phosphates, citrates (notamment le citrate de sodium), formiates, tartrates tels que le tartrate de sodium ou de potassium, le tartrate double de sodium et de potassium, tes chlorures, iodures et fluorures, par exemple NaCI ; les polymères tels que les polyéthylèneglycols et la Jeffamine T ; l'éthanol, le dioxane, le méthylpentanediol, le glycérol, l'isopropanol, 2-méthyl-2,4-pentanedîol.
    De manière avantageuse, dans la solution, le complexe est présent à une concentration de 1 à 100 mM, préférentiellement à une concentration de 1 à 25 mM, et de manière encore plus préférée à une concentration de 10 mM ± 10%.
    En particulier, l'obtention de cristaux est réalisée par cristallisation par diffusion de vapeur, par dialyse, en batch ou encore dans un procédé de cristallisation en phase cubique de lipides.
    Le procédé de cristallisation selon l'invention pourra être intégré à un criblage ou à une optimisation de conditions de cristallisation d'une macromolécule biologique. Le procédé de cristallisation selon l'invention pourra être mis en œuvre de manière automatisée. L'invention a également pour objet un procédé d'analyse ou de détermination de 1a. structure d'une macromolécule biologique comprenant les étapes suivantes : a) disposer d'un cristal dérivé de la macromolécule biologique tel que défini dans le cadre de l'invention, b) analyser la structure cristalline de la macromolécule biologique à partir dudit cristal dérivé.
    Le cristal dérivé pourra être obtenu selon un procédé de cristallisation tel que décrit dans te cadre de l'invention ou encore par trempage d'un cristal de la macromolécule biologique dans une solution d'un complexe selon l'invention ou d'un complexe cationique formé d'un ion ianthanide Ln3+ et d'un ligand de formule (1.1) à (1.5) telle que précédemment définie, ou d'un de leurs sels avec un anion, leurs solvats ou hydrates. Le cristal dérivé peut également être obtenu par trempage d'un cristal dérivé de la macromolécuie biologique obtenu selon un procédé de cristallisation tel que décrit dans le cadre de l'invention, dans une solution d'un complexe selon l'invention ou d'un complexe cationique formé d'un ion Ianthanide Ln3+ et d'un ligand de formule (1.1) à (1.5) telle que précédemment définie, ou d'un de leurs'sels'avec un anion, leurs solvats ou hydrates.
    En particulier, l'analyse de la structure cristalline de la macromolécule biologique à partir dudit cristal dérivé correspond à' la détermination de la structure de la macromolécule biologique et est réalisée par diffraction des Rayons X. (RX). Il est également possible qu'elle corresponde à l'obtention de données structurales par une méthode haute résolution, telle que la diffraction des Rayons X (RX) ou par une méthode à basse résolution par les méthodes SAXS (Small-Angle X-ray Scattering) ou MASC (Multîwavelength-Anomalous Solvent Contrast).
    La description détaillée ci-après permet de mieux comprendre t'invention.
    Les complexes cationiques formés d'un ion Ianthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF) sont des complexes cationiques, et en particulier mono-cationiques. Ils sont: donc capables de conduire à la formation de cristaux dérivés d'une macromolécule biologique. De tels cristaux dérivés peuvent '' être obtenus par trempage ou par co-cristallisation, comme détaillé plus loin. L'effet anomal dû à la présence des lanthanides dans les cristaux dérivés obtenus, conduit à un effet phasant et facilite la détermination de la structure de la macromolécule biologique concernée, notamment par diffraction des rayons X. Les complexes selon l'invention peuvent donc être utilisés en tant qu'aide à la détermination ou à l'analyse de la structure cristalline d'une macromolécule biologique.
    Les complexes cationiques formés d'un ion lanthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), ainsi que leurs sels, solvats et hydrates peuvent également être utilisés en tant qu'aide à la cristallisation de macromolécules biologiques. En effet, en fonction de leur structure, et en fonction des conditions de cristallisation mises en œuvre, les complexes selon l'invention présentent au moins l'une des propriétés suivantes : - effet nucléant : la présence dudit complexe de lanthanide lors de la cristallisation provoque la croissance de cristaux dans des conditions (tampon et/ou additifs et/ou température et/ou concentration et/ou durée...) qui ne permettent pas la formation de cristaux en l'absence du complexe selon l'invention. - effet cristallisant : la présence dudit complexe de lanthanide lors de tests d'une série de conditions de cristallisation (nombre de cristaux et/ou taille des cristaux et/ou amélioration de la diffraction des cristaux obtenus.,.) permet d'améliorer la cristallisation obtenue, par rapport à une série de conditions différant par l'absence de complexe. En l'absence de complexe, des cristaux apparaissent mais sont de moins bonne qualité.
    En particulier, les complexes de lanthanide formés avec les ligands de formule (I) formés d'un ion lanthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), ainsi que leurs sels, solvats et hydrates, soit permettent d'augmenter le nombre de conditions dans lesquelles l'obtention de cristaux d'une macromolécule biologique est possible, soit de travailler dans des conditions plus faibles en macromolécule biologique et/ou en autre agent précipitant classiquement utilisé, soit d'améliorer la qualité ou le nombre de cristaux 'favorisant ainsi l'obtention de données structurales ultérieures, soit d'obtenir plusieurs de ces avantages.
    Les complexes d'Europium et de Terbium présentent également l'avantage d'être luminescents sous irradiation UV. Ainsi, leur utilisation permet une mise en évidence aisée des cristaux dérivés lors des essais de cristallisation. Cette propriété peut être utilisée comme méthode de détection rapide pour les plateformes de cristallisation équipées d'imageur automatique sous irradiation UV. De plus, cette propriété peut être utilisée comme une aide au centrage dans un faisceau de rayons X lors d'une caractérisation par diffraction notamment.
    Les complexes selon l'invention pourront être préparés selon des techniques adaptées par l'homme du métier, techniques décrites dans les exemples ou dans la demande WO 2014/182105. La synthèse des complexes selon l'invention est généralement réalisée dans l'eau. Les complexes ainsi formés seront donc plutôt sous la forme d'hydrate, mais le complexe peut ensuite être mis dans un solvant autre, du type alcool ou DMSQ et donner lieu à un solvat ou encore être déshydraté. Sous forme hydratée, un complexe selon l'invention comportera, notamment jusqu'à 3 molécules d'eau par complexe. En moyenne, le nombre de molécules d'eau par complexe, pourra, par contre, être différent d'un nombre entier, et être par exemple égal à 0,5. Pour les applications envisagées dans le cadre de l'invention, les complexes de lanthanide selon l'invention pourront être utilisés sous forme hydratée, ou déshydratée, solvatée ou.non, sous.la forme de poudre ou en solution.
    La qualité et la pureté d'un agent cristallisant sont essentielles au bon déroulement de la cristallisation d'une macromolécule, lorsque ces derniers sont utilisés en tant qu'agent de cristallisation. Aussi, au final, les complexes de lanthanide selon l'invention seront soumis à une étape de purification adaptée, notamment par chromatographie d'exclusion stérique.
    Les complexes cationiques formés d'un ion lanthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), ainsi que leurs sels, solvats et hydrates, pourront être utilisés en tant qu'agent cristallisant dans toute technique adaptée à la cristallisation de macromolécules biologiques.
    Pour une description détaillée de telles techniques, on pourra se référer aux ouvrages de référence suivants: « Protein Crystallization, Second Edition (IUL Biotechnoiogy Sériés) » édité par Therese Bergfors ou « Crystallization of Nucleic Acids and Proteins: A Practical Approach » édité par Arnaud Ducruix et Richard Giegé.
    En particulier, les complexes cationiques formés d'un, ion lanthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), ainsi que leurs sels, solvats et; hydrates pourront être utilisés en tant qu'agent cristallisant dans un procédé de cristallisation de macromolécules biologiques par diffusion de vapeur, par dialyse, en batch ou encore dans un procédé de cristallisation en phase cubique de lipides.
    Ces différentes techniques vont chacune être décrites succinctement, l'agent cristallisant s'entendant d'un complexe de lanthanide ou mélange d'agents cristallisants contenant au moins un complexe de lanthanide avec un ligand de formule (I), sous forme de sels, solvats ou hydrates : - La cristallisation par diffusion de vapeur est la plus''Utilisée actuellement. C'est la méthode généralement mise en œuvre au niveau des plateformes de cristallisation automatisée. Il existe trois approches différentes schématisées sur la Figure 2 : les techniques de la goutte assise" (« Sitting drop » en anglais), de la goutte suspendue (« Hanging drop » en anglais) et de la goutte en sandwich (« Sandwich drop » en anglais). Ces trois techniques sont représentées schématiquement sur la Figure 2.
    Dans ces trois approches, une solution de l'agent cristallisant est placée dans un puits (solution en gris clair), La solution contenant la macromolécule biologique d'intérêt est mélangée avec l'agent cristallisant et déposée sous forme de goutte (soit suspendue, soit assise ou encore en sandwich). Le puits de cristallisation est fermé hermétiquement par une lamelle de verre ou un film plastique. Au démarrage de la cristallisation, la concentration en agent cristallisant dans la goutte est deux fois plus faible que dans le puits. Le système étant clos, il se met en place une cinétique de diffusion du solvant de la goutte (généralement de l'eau) vers le puits. Le volume de la goutte va donc diminuer (perte de solvant ie. d'eau) et les concentrations en macromolécule biologique et en agent cristallisant vont ainsi augmenter permettant, dans les cas favorables, d'atteindre la phase de nucléation. Dans cette méthode, la concentration en agent cristallisant est extrêmement importante. En effet, un excès d'agent cristallisant pourrait entraîner une cinétique de diffusion du solvant trop rapide et donc entraîner la précipitation de la macromolécule biologique. A l'inverse, une concentration trop faible ne permettra pas d'atteindre la zone de nucléation. La concentration adaptée en agent cristallisant sera donc déterminée, par des tests de routine, par l'homme du métier. A partir de la nucléation, la croissance cristalline va ensuite faire diminuer la concentration en macromolécule soluble jusqu’à atteindre un état stationnaire. - La dialyse est une autre méthode de cristallisation qui reste cependant moins utilisée que la diffusion de vapeur. Cette technique est représentée schématiquement sur la Figure 3.
    Le principe générai consiste à faire croître, de manière lente, la concentration en agent cristallisant. Pour cela, une solution contenant la macromolécule biologique d'intérêt est placée dans un contenant de dialyse, par exemple du type capillaire ou bouton de dialyse fermé par une membrane semi-perméable laissant passer ies molécules d'agent cristallisant (mais pas la macromolécule). Ce contenant est alors placé dans une solution d'agent cristallisant. Un équilibre entre la solution contenant la macromolécule biologique d'intérêt (qui ne contient pas d'agent cristallisant) et la solution extérieure contenant l'agent cristallisant va se mettre en place. Ainsi, la concentration en agent cristallisant dans le contenant de dialyse va augmenter et modifier la solubilité de la macromolécuie. Cette technique présente l'avantage d'être plus précise'que la diffusion de vapeur en ce qui concerne le maintien du pH et des volumes. Cependant, la manipulation des cristaux reste beaucoup plus délicate. - La cristallisation en batdresbla dernière technique utilisée pour cristalliser les macromolécules biologiques." Cette technique, tout comme la dialyse, nécessite un volume important de solution."
    Le principe de cette technique, représenté schématiquement sur la Figure 4, est simple : la macromolécule très concentrée est mélangée à l'agent cristallisant. La solution sursaturée en macromolécuie va, avec le temps, induire la formation de nucléii qui va induire la diminution de la concentration de la macromolécuie en solution, vers la formation de cristaux.
    Les techniques de cristallisation par diffusion de vapeur, de cristallisation par dialyse ou de cristallisation en batch fonctionnent sur tous les types de protéines qu'elles soient solubles dans l'eau ou qu'elles soient membranaires, alors solubles en détergent, ainsi que sur les autres macromolécules biologiques (ADN, ARN, complexes protéiques, complexes protéine-ADN ou ARN...).
    Pour la cristallisation des protéines membranaires, il est également possible d'utiliser un complexe de lanthanide, en tant qu'agent cristallisant dans une technique de cristallisation en phase cubique de lipides. La cristallisation en phase cubique de lipides des protéines membranaires est décrite dans les publications suivantes : Landau et al. Lipidic cubic phase: A novel concept for the crystallization of membrane proteins, PNAS Vol. 93 no. 25 14532- 14535 (1996), Caffrey et al, Crystallizing membrane proteins using lipidic mesophases. Nat Protoc 4 (5) 706-31 (2009), Cherezov V., Lipidic cubic phase technologies for membrane protein structural studies. Curr. Opin Str vi:·! vol 21 559-566 (2011).
    Les complexes de lanthanide formés d'un ion lanthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), ainsi que leurs sels, soivats et hydrates sont compatibles avec toutes tes méthodes de cristallisation qui viennent d'être détaillées.
    En particulier, ..une solution contenant une concentration de 1 à 100 mM, préférentiellement .1. à 25 mM d'un, complexe de lanthanide formés d'un ion lanthanide Ln3+.et.d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), sous forme d'un se!. avec un anion, éventuellement .sous la forme d'un solvat ou d'un hydrate, et de manière encore plus préférée de 10 mM ± 10% sera utilisée.
    Dans les cristallisations, en particulier, en phase vapeur ou en batch, une solution de ta macromolécule biologique à cristalliser et d'un complexe de lanthanide formé d'un ion lanthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), sous forme d'un sel avec un anion, éventuellement sous la forme d'un solvat ou d'un hydrate (qui sera, par souci de simplification, dans le reste de la description, nommé complexe de lanthanide), sera préparée, avec de préférence une concentration de 1 à 100 mM, préférentiellement 1 à 25 mM, et de manière encore plus préférée de 10 mM ± 10%, en complexe de lanthanide. Le complexe de lanthanide formé d'un ion lanthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), sous forme d'un sel avec un anion, éventuellement sous la forme d'un solvat ou d'un hydrate, peut être directement solubilisé par la solution contenant la macromolécuie biologique pour atteindre une concentration finale en complexe de 1 à 100 mM, de préférence· de 1 à 25 mM, et préférentiellement de 10 mM ± 10% qui correspond à la concentration à laquelle l'effet nucléant est prépondérant. Le complexe de lanthanide peut aussi être introduit à partir d'une solution à une concentration préférentielle de 10 à 30 mM, lors de la fabrication d'une goutte de cristallisation : sont alors ajoutés successivement un volume de la solution de macromolécules, un volume Identique de la solution de complexe de lanthanide et un volume identique de solution de puits· utilisé pour la cristallisation.
    Dans ces techniques de cristallisation, le complexe de lanthanide et la macromolécule biologique à cristalliser seront mis en solution généralement dans de l'eau ou dans une solution aqueuse tamponnée (voir exemples dans la description des kits de cristallisation figurant dans les Annexes 2A et 2B), par exemple, dans une solution tampon acétate, cacodylate, citrate, Bis tris propane, TRIS, HEPES, phosphate. Les solutions contenant une macromolécule biologique sont généralement tamponnées. Si une solution du complexe de lanthanide est formée, elle ne sera pas forcément tamponnée. La solution contenant le complexe, la solution contenant la macromolécule biologique et/ou la solution contenant la macromolécule biologique et le complexe, en fonction de la technique de cristallisation utilisée présenteront, de préférence, un pH dans la gamme allant de 3 à 9.
    Des additifs tels que des additifs déjà connus -pour jouer le rôle d'agent précîpitant/crîstaîlisant ou des additifs permettant de favoriser au -départ la dissolution de la macromolécule biologique à cristalliser pourront être ajoutés. A titre d'exemples, on peut citer ceux présents dans les tableaux présentés en Annexe 2A ou 2B, comme par exemple, les - sels tels que les sels d'ammonium, les sulfates (notamment le sulfate d'ammonium), acétates, phosphates, citrates (notamment le citrate de sodium), formiates, tartrates tels que ;le tartrate de.'sodium ou de potassium, le tartrate double de sodium et de potassium:, les chlorures, iodures et fluorures, par exemple WaO ; les polymères tels que les polyéthylèneglycols et la Jeffamine T ; l'éthanol, le dioxane, le méthylpentanediol, le glycéroî, l'isopropanol, 2-méthyl-2,4-pentanediol. En particulier, il est possible d'utiliser le complexe de lanthanide dans toute solution de cristallisation déjà commercialisée.
    La concentration en macromolécule dans la solution sera en théorie proche de sa limite de solubilité dans ladite solution, mais pourra être plus diluée, en fonction de la solution utilisée.
    Les complexes de lanthanide formés d'un ion lanthanide Ln3+ et d'un ligand de formule (I), correspondant aux complexes selon l'invention ou aux complexes formés avec un ligand de formule (IA) à (IF), sous forme d'un sel avec un anion, éventuellement sous la forme d'un solvat ou d'un hydrate, pourront également être utilisés pour obtenir des cristaux dérivés de macromolécules biologiques, c'est-à-dire des cristaux contenant ledit complexe de lanthanide. En particulier, ledit complexe de lanthanide sera fixé sur une position spécifique de la macromolécule biologique à étudier permettant la détermination de la structure de ladite macromolécule biologique étudiée.
    La détermination des phases peut être faite avec des cristaux dérivés obtenus dans une solution contenant de 1 à 100 mM de complexe, préférentiellement de 10 à 100 mM, et de manière encore plus préférée de 100 mM ± 10% au dit complexe de lanthanide. Cependant, pour améliorer la qualité du phasage, un trempage dans une solution d'un complexe de lanthanide, en particulier, avec une concentration élevée en complexe, peut également être réalisé. Cela permet d'augmenter le taux d'occupation des sites occupés parle complexe.
    La co-cristallisation consiste donc à ajouter le complexe de lanthanide pendant le processus de cristallisation. Ainsi, lors de la cristallisation, le complexe de lanthanide peut s'insérer dans des sites cristallins spécifiques conduisant à l'obtention de cristaux dérivés.
    Par ailleurs, pour obtenir un cristal dérivé ou augmenter l'occupation par un complexe de lanthanide de sites dans le cristal dérivé, un trempage d'un cristal d'une macromolécule biologique dans une solution de complexe de lanthanide peut être effectué. I! est possible de réaliser un trempage rapide ou un trempage long.
    Le trempage rapide consiste à prélever un cristal d'une macromolécule biologique d'intérêt et à le tremper de manière brève (notamment de 45 secondes à 2 minutes) dans une solution du complexe de lanthanide. De manière avantageuse, la solution dans laquelle le cristal est trempé présente une forte concentration en complexe de lanthanide, typiquement une concentration de 50 à 500 mM, de préférence de 100 mM ± 10%.
    En particulier, un trempage rapide lors d'une phase de congélation d'un ou plusieurs cristaux peut être réalisé. Un trempage rapide lors d'une phase de congélation se déroule typiquement en trois étapes ; des cristaux sont prélevés de leur goutte d'origine et trempés dans une goutte de trempage, correspondant à une solution équivalente à la solution d'origine utilisée pour la formation du{des)dtt(s) cristal(aux) à laquelle est ajoutée une concentration de 50 à 500 mM, de préférence de 100 mM. ± 10% de complexe de lanthanide, ainsi qu'un cryoprotectant tel qu'utilisé par l'homme de l'art. Après une durée de 45 secondes à 2 minutes, le cristal est trempé 'dans une solution de cryoprotectîon sans complexe de lanthanide, afin d'en éliminer l'excès. Enfin, le cristal est plongé dans l'azote liquide et stocké à basse température, par exemple à 1QQK.
    Cette méthode de trempage est très efficace et permet d'augmenter les taux d'occupation et d'améliorer la qualité du phasage. A titre d'exemple, dans le cas de ia protéine PhPl un trempage'-de 45 secondes dans une solution à 100 mM de complexe 10 :a-augmenté le taux d'occupation du complexe par 3. Un trempage court permet d'éviter que.· 1e. cristal ne se dégrade et de préserver les qualités de diffraction de ce dernier.
    Le trempage long consiste à prélever un cristal d'une macromolécule biologique d'intérêt et à le tremper de manière prolongée (notamment de 10 minutes à 24 heures) dans une solution du complexe de lanthanide. De manière avantageuse, la solution dans laquelle le cristal est trempé présente une forte concentration en complexe de lanthanide, typiquement - une concentration de 50 à 500 mM., de préférence de 100 mM ± 10%. A l'exception de la durée:, le trempage long peut se dérouler selon le même protocole que celui décrit pour le trempage'rapide, notamment lors d'une phase de congélation. Cependant, la goutte de trempage est placée en équilibre avec un puits contenant de la solution d'origine utilisée pour la formation du(des)dit(s) cristal (aux), afin d'éviter une déshydratation de la goutte.
    Quel que soit le type de trempage, il est possible de''tremper aussi bien des cristaux obtenus par co-cristallisation, en présence d'un complexe de lanthanide, que des cristaux obtenus en l'absence d'un tel complexe (nommés cristaux natifs dans le cadre de la présente demande de brevet). Le trempage n'entraîne aucune destruction ou modification de la macromolécule biologique.
    Les complexes de tanthanide permettent de former des cristaux dérivés d'une macromolécule biologique permettant l'obtention de données structurales pour ladite macromolécule biologique. En particulier, l'obtention de données structurales sera obtenue à partir d'un cristal dérivé d'une macromolécuie biologique intégrant un complexe de lanthanide qui joue le rôle d'agent phasant. Ces données structurales pourront être obtenues par une méthode haute résolution, telle que la diffraction des Rayons X (RX) ou par une méthode basse résolution, telles que les méthodes SAXS et MASC. Les complexes de lanthanide pourront être utilisés en tant qu'agent phasant en diffraction des RX (cristallisation et analyse de structure) ou en diffusion des RX, ou encore en tant qu'agent de contraste en SAXS ou MASC, en microscopie électronique. L'utilisation des complexes de lanthanide formés d'un ion lanthanide Ln3+ et d'un ligand-de formule (I), correspondant aux complexes selon l'invention ou aux . complexes formés avec un ligand de formule (IA) à (IF), sous forme d'un sel avec un anïon, éventuellement sous la forme d'un solvat ou d'un hydrate, en tant qu'agent phasant notamment, présente l'avantage de ne pas nécessiter une modification de la macromolécule biologique par génie génétique, comme dans le cas de l'obtention de protéines séléniés. Aucune liaison covalente n'intervient entre le complexe de lanthanide et la macromolécule biologique d'intérêt
    Les exemples ci-après, en référence aux figures annexées, permettent d'illustrer l'Invention mais ne présentent aucun, caractère limitatif.
    La Figure 1 représente un diagramme de phase, illustrant le processus de cristallisation (Extrait de http://people.ds.cam.ac.uk/ml527/publications/assets/leunissen-literature-research.pdf)
    La Figure ,-2 représente trois approches différentes: les techniques de la goutte assise (« Sitting drop » en anglais), de la goutte suspendue (« Hangîng drop » en anglais) et de la goutte en sandwich (« Sandwich drop » en anglais).
    La Figure 3 représente la technique de dialyse : autre méthode de cristallisation qui reste cependant moins utilisée que la diffusion de vapeur.
    La Figure 4 représente schématiquement une technique de cristallisation en batch utilisée pour cristalliser tes macromolécules biologiques.
    La Figure 5 représente des diagrammes de phase de la protéine lysozyme en absence (à droite) et en présence de complexe 10 ou 17 déterminés à différents temps de cristallisation : les conditions, ayant donné des cristaux, sont illustrées par des points noirs, les points blancs étant des gouttes claires.
    La Figure 6 représente des diagrammes de phase du lysozyme de blanc d'œuf de poule en absence et en présence de lûmM de complexe 11 déterminés après 4 jours de cristallisation. Les conditions donnant des cristaux sont illustrées par des points noirs, les points blancs sont des gouttes claires et les triangles des précipités.
    La Figure 7 représente des diagrammes de phase de la protéine PB6 en absence et en présence de lOmM de complexe 10 déterminés après un jour de cristaliisation. Les conditions donnant des cristaux sont illustrées par des points noirs, les points blancs sont des gouttes claires et les triangles des précipités.
    La Figure 8 représente des cristaux de pb6 (condition pb6-l) en présence de 10 mM de complexe 10 à droite (13% PEG - 10 mg/mi) et sans complexe 10 à gauche (15 % PEG - 20 mg/ml).
    La Figure 9 représente la mise en évidence de la luminescence induite dans les cristaux par les complexes de îanthanide.
    La Figure 10 représente un spectre de fluorescence X mesuré sur une solution de 10 mM de complexe 10 (à gauche) et traitement par le logiciel CHOOCH (à droite). Les longueurs d'onde pour les enregistrements permettant d'exploiter de manière optimale la diffusion anomale du Ianthanide (ici le terbium) sont indiquées par une flèche.
    La Figure 11 représente des exemples de cartes de densité électronique expérimentale.
    La Figure 12 représente des images obtenues au robot de cristallisation HTXIab.
    Exemples de réalisation
    Partie I : Synthèse et caractérisation des complexes Les abréviations ci-après sont utilisées :
    Me = méthyle
    Moz = méthoxybenzyloxycarbonyle
    Boc = tert-butoxycarbonyle Ms = mésyie
    Et = éthyle TA = température ambiante Ac = acétyle DCM = dichiorométhane TACN = triazacyclononane DM F = diméthylfbrmamide TFA. = acide trifluoroacétique.... ACN = acétonitrile CCM = chromatographie sur couche mince Produits de départ et caractérisation
    Tous les produits de départ, solvants et sels de lanthanide ont été achetés chez Sigma-Aldrich®, Acros Organics® et TCI® avec des puretés supérieures à 98% pour les composés organiques et supérieures à 99,99% pour les sels de lanthanide. Ces produite ont été utilisés directement sans purification supplémentaire.
    Les chromatographies ont été effectuées, d'une part, sur alumine neutre activité III obtenue par hydratation d'alumine Acros Organics® d'activité I (60Â), et d'autre part, sur gel de silice Acros Organics® (60Â). Les complexes formés ont tous été purifiés par colonne d'exclusion stérique LH20 de chez Sephadex®.
    Les spectres RMN (XH, 13C) ont été enregistrés sur deux appareils Bruker® Avance opérant respectivement à 500.10 MHz et 125.75 MHz pour dH et 13C pour i'un, et à 300 MHz pour *H pour le second. Les déplacements chimiques sont reportés en partie par million (ppm) relativement au signal du tetrarriéthylsiiane (*H, 13C), les pics résiduels des solvants étant utilisés comme référence interne.
    Les mesures de masses exactes ont été effectuées au Centre Commun de spectrométrie de Masse (Villeurbanne, France). A) Préparation d'une première série de ligands/complexes à base de triazacyciononane (TACN)
    a) HCl (cat.) dans MeOH b) NaBH4dans DCM/MeOH c) MsCI, Et3N dans DCM d) Moz-on, Et3N dans ACN e) Boc-O-sucdnimîde dans DCM f) H2, Pd/C dans MeOH g) Na2C03 dans MeOH/H20 h) TFA dans DCM 1) Na2C03 dans ACN j) Na2C03 dans H20 puis LnCh,6(H20) avec Ln=Tb ou Eu
    Le composé 6 a été préparé selon la procédure précédemment décrite dans ia demande de brevet W02013/011236A1,
    Al) Préparation, du composé 1
    A une suspension de 20 g d'acide dipicoiinlque (0,12. mol, léq.) dans 120 m!_ de méthanol, on ajoute 1 ml d'acide sulfurique concentré, Le mélange est porté à reflux pendant 24h. Après refroidissement, le produit cristallisé est filtré et rincé au méthanol froid pour donner, après séchage, 18 g de poudre cristalline blanche du composé 1 (R = 78%). *H-NMR (300 MHz, CDC13) δ (ppm) = 8.26 (d, J = 8 Hz, 2H), 7.99 (t, J = 8 Hz, 1H), 3.98 (s, 6H). A23 Préparation du composé 2
    18 g de composé 1 (92 mmol, 1 éq.) sont dîssouts dans 450 ml de méthanol et refroidis à 0°C. 3,8 g de NaBH4 (101,2 mmol, 1,1 éq.) sont alors ajoutés. Le mélange est ensuite agité 30 min à 0°C et 30 min supplémentaires en laissant la température remontée lentement jusqu'à TA. La réaction est stoppée par ajout de 50 mL de HCI (IM dans H20), puis, la phase organique est extraite avec 100 mL de dichiorométhane. Après, lavage de la phase organique avec de la saumure (jusqu'à pH = 7), séchage avec Wa25G4 et évaporation, le produit obtenu, est purifié par chromatographie sur gel de silice (éluant: DCM/AcOEt 9/1 v/v jusqu'à'AcOEt pur). On obtient 6 g d'un solide blanc du composé 2 (R. = 40%). ^-NMR (300 MHz, CDCI3) δ (ppm) = 8.01 (d, J = 8 Hz, 1H), 7.84 (t, J = 8 Hz, 1H), 7.53 (d, 3 = 8 Hz, 1H), 4.85 (d, J = 3 Hz, 2H), 3.98 (s, 3H), 3.69 (bs, 1H). A3) Préparation du composé 3
    A une solution de 1,2 g de l'alcool 2 dans 50 mL de dichlorométhane à 0°C, on ajoute 3mL de Et3N (22 mmol, 3,2 éq.) puis, rapidement, 0,79 mL de chlorure de mésyle (10,2 mmol, l,5éq.). On laisse ensuite le mélange revenir à température ambiante avant de le chauffer pendant lh à 50°C. On ajoute ensuite 40 mL d'eau et on extrait le mélange au dichlorométhane (3x20 mL), Le résidu huileux obtenu, après séchage et évaporation des phases organiques, est finalement purifié sur gel de silice (éluant : CH2CI2) pour obtenir une huile incolore du composé 3 qui cristallise au congélateur. MMR (500 MHz, CDCI3) δ 8.12 (d, 3 = 7.7 Hz, 1H), 7.93 (t, 3 = 7.8 Hz, 1H, H10), 7.70 (d, 3 = 7.8 Hz, 1H), 5.44 (s, 2H, H7), 4.01 (s, 3H, OMe), 3.15 (s, 3H, OMs), 13C NMR (126 MHz, CDCI3) δ 165.33 (C13),: 154.59 (s), 147.92 (s), 138.45 (CIO), 125.41 (s), 125.13 (s), 71.11 (C7), 53.23 (OMe), 38.24 (OMs). A4) Préparation du composé' 6
    Le composé 6 est préparé par la méthode précédemment décrite, (a) W02013011236A1 ; b) l.S. 3. Butler, B. K. McMahon, R. Pal, D. Parker and 3. W. Wallon, Chem. Eur. 3., 2013, 19, 9511-9517.) A5) Préparation du composé 7
    360 mg de composé 6 (1,19 mmol) et 760 mg de carbonate de sodium (7,15 mmoi, 6 éq.) sont séchés sous pression réduite dans un schlenk avant d'ajouter 100 ml d'acétonitrile. Sous argon, 710 mg de composé 3 (2,74 mmol, 2,3 éq.) sont ajoutés à la suspension avant chauffage 12h à 70°C. Après retour à la température ambiante, le mélange est filtré sur fritté (porosité 4) et concentré sous pression réduite. Le produit est purifié par chromatographie sur alumine (activité III, éluant DCM puis DCM/MeOH 96/4 v/v) pour finalement obtenir une huile jaune du composé 7 (532 mg, Rendement : 80%). *H NMR (500 MHz, CDCfe) δ 7.99 (dd, 3 = 6 Hz, 2H, Hll), 7.86 - 7.65 (m, 4H, H9), 3.98 (s, 10H, H7+OMe), 3.39 (d, 3 = 30 Hz, 4H, H4H5),'3.11 (s, 2H, H3H6), 2.95 (s, 2H, Η3Ή6'), 2.66 (d, 3 = 31 Hz, 4H, H1H2), 1.44'(s, 9H, boc). 13C NMR (126 MHz, CDCi3) δ 166.01, 166,09 (C13), 161.43, 161.60 (C8), 155.88(CO(boc)) 147.45(C12), 137,42 (d,C10), (s), 126.19,126.46 (C9), 123.70 (Cil), 79.48 (C(boc)), 63.70 (d, C7), 57.21 (C1C2), 55.37 (s), 55.11 (s), 54,67 (s), 53.04 (OMe), 50.54, 49.95 (C4C5), 28.72 (CH3(boc)). A6) Préparation du composé 8
    Dans 100 ml de dichlorométhane, 5 ml d'acide trifluoroacétique sont ajoutés sur une solution de 427 mg du composé 7. Après 5h d'agitation à la température ambiante, le mélange est évaporé en éliminant le TFA par entrainement avec plusieurs ajouts de toluène. Le résidu obtenu est purifié par chromatographie sur alumine (activité III, éluant DCM/MeOH (gradient 1% jusqu'à 7%)). Le solide visqueux jaunâtre obtenu du composé 8 est conservé sous argon au congélateur (masse : 315 mg, rendement ; 90%). XH NMR (500 MHz, CDCh) δ 7.96 (dd, 3 = 7.7, 0.5 Hz, 2H, Hll), 7.71 (t, J = 8 Hz, 2H, H10), 7.42 (dd, 3 = 7.9, 0.5 Hz, 2H), 3.98 (d, 10H, H7+OMe), 3.40 (t, 3 = 5 Hz, 4H, H4H5), 3.03 (t, 3 = 5 Hz, 4H, H3H6), 2.71 (s, 4H, H1H2). 13C NMR (126 MHz, CDCI3) δ 165.37 (C13), 159.43 (C8), 147.59 (C12), 137.87 (CIO), 126.10 (C9), 124.02 (Cil), 60.95 (C7), 54.60 (C1C2), 53.31 (OMe), 51.66 (C3C6), 46.52 (C4C5). NB : la synthèse de ce composé a été précédemment décrite dans la référence suivante : A. Nonat, C. Gateau, P. H. Fries, M. Mazzanti, Chem. Eur. 3., 2006, 12, 7133. A71 Préparation du composé 9
    Le ligand 9 est généré in situ par saponification du diester 8 en présence de carbonate de sodium Ν32€03 (2 éq.) dans un mélange MeOH/H20 (1/1, v/v) agité 3h à 50°C. *H NMR (500 MHz, D20) δ 7.77 (d, 3 = 7.1 Hz, 2H, H9), 7.69 (t, 3 = 7.7 Hz, 2H, H10), '7.29 (d, 3 = 7.2 Hz, 2H, Hll), 3.86 (s, 4H, H7), 3.08 (t, 3 = 5.9 Hz, 4H, H4H5), 2.91 (t, 3 = 5.9 Hz, 4H, H3H6), 2.65 (s, 4H, H1H2). 13C NMR (126 «Hz, DzO) δ 173.22 (C13), 158.44 (C8), 153.01 (€12), 138.23 (CIO), 125.17 (Cil), 122.40 (C9), 60.27 (C7), 50.53 (C1,C2), 47.12 (C3,C6), 44.10 (C4,C5). aa) Préparation du complexe 10
    Après réaction pendant 3h à 50°C de 110 mg de diester 8 (0,26 mmol) avec 83 mg de NaiCOa (0,78 mmol, 3,0 éq.) et neutralisation par HCl (IM), la disparition de l'ester est vérifiée par RMN. 96 mg de chlorure t )ium (0,26 mmol, 1 éq.) sont ajoutés au composé 9, formé in situ, avant d'agiter le mélange pendant 12h à 5Û°C Solubilisé dans un minimum de méthanoi, le complexe 10 est ensuite séparé des différents sels par centrifugation. L -s demie me -.ces de sels sont retirées par passage sur une colonne d'exclusion stérique (LH20, Sephadex®, éluant : eau). MS (ESI-TOF) calculé M+ : 556.1003 ; mesuré : 556.0990 A91 Préparation du complexe 11
    Un protocole identique à celui mis en œuvre pour la préparation du complexe 10 est utilisé avec 170 mg de diester 8 (0,4 mmol) et 219 mg de Eu€I3l6H20 (0,6 mmol, 1,5 éq.). MS (ESI-TOF) calculé M+ : 550,0962 ; mesuré : 550,0957. B) Préparation d'une deuxième série de ligands à base de triazacyclononane (TACN)
    B 11 Préparation do composé 12
    15 g d'acide chélidamique monohydrate (0,075mol, léq.) sont dissouts dans. 120 mL de chlorure de thionyie sous argon, La suspension. est refroidie à 0°C et 3 ml de DMF sont ajoutés. Le mélange réactionnel est ensuite.agité pendant 12h à reflux. Les .... volatiles sont évaporés après plusieurs ajouts de toluène pour enlever Ses dernières traces de SOCb·. Le solide jaunâtre obtenu est ensuite dissout dans du méthanol et le mélange est porté à reflux pendant 12h pour achever la réaction. Après, évaporation du solvant, le résidu est repris par du dichlorométhane et lavé successivement par une solution saturée de NaHC03, d'eau et de saumure. La phase organique est ensuite séchée sur Na2S04, filtrée et évaporée. Le composé 12 pur est obtenu par recristallisation dans le méthanol pour obtenir 8,3g de poudre cristalline blanche. (R = 44%). ^-NMR (300 MHz, CDCI3) δ (ppm) = 8.29 (s, 2H), 4.03 (s, 6H). B21 Préparation du composé 13
    6 g de composé 12 (0,026 mol, léq.) sont dissouts dans 250 mL d'un mélange DCM/ méthanol (150/100, v/v) et la solution est refroidie à 0°C. Puis, 1,09g de NaBH4 (0,029 moi, 1,1 éq.) sont ajoutés en une fois avant agitation du mélange pendant 30 min : ’C et 30 minute à TA. La réaction est stoppée par l'ajout de 50 mL d'acide chlorhydrique (IM) et de 100 mL d'eau. La phase organique est ensuite iavée à l'eau jusqu'à atteindre un pH = 7, puis lavée à la saumure, séchée sur Na2S04 et évaporée. Le brut réactionnel est ensuite purifié sur gel de silice (éluant : DCM/ AcOEt 1/1 v/v) pour obtenir après évaporation 1,5g d'une poudre blanche composé 13 (R = 30%). ^-NMR (300 MHz, CDCI3) δ (ppm) = 8.00 (bd, 1H), 7.60 (bd, 1H), 4.85 (d, J = 7 Hz, 2H), 3.99 (s, 3H) 3.48 (t, J = 7 Hz, 1H). B3) Préparation du composé 14
    1,5 g de composé 13 (7,4 mmol, 1 éq.) sont dissouts dans 200 mL de dichlorométhane et 3 mL de triéthylamine sont ajoutés (22,2 mmol, 3 éq.). Puis, 0,87 mL de chlorure de mésyle sont ajoutés (11,1 mmol, 1,5 éq.) lentement et une coloration jaune progressive du mélange est observée. L'avancement de la réaction est suivie par CCM et stoppée après 30 min. 100 mL d'une solution saturée de NaHC04 sont ajoutés puis la phase organique est lavée à l'eau (jusqu'à pH = 7) et avec de la saumure. La solution organique est ensuite séchée sur Na2S04 et évaporée pour donner 2 g d'une huile jaune du composé 14 utilisée sans purification supplémentaire (rendement quantitatif). *H-NMR (300 MHz, CDCI3) δ (ppm) = 8.1 (s, 1H), 7.68 (s, 1H), 5.40 (s, 2H), 4.01 (s, 3H), 3.17 (s, 3H). B41 Préparation du composé 15
    200 mg of triazacyclononane mono-boc (0,7 mmol, léq.) sont mis en suspension dans 100 mL d'acétonîtrile sec avec 420 mg de carbonate de sodium anhydre. 463 mg de composé 13 (1,75 mmol, 2,5 éq.) sont ensuite ajoutés. Après refroidissement, le mélange est passé sur fritté pour enlever le carbonate avant évaporation du solvant. Le résidu est repris dans du dichlorométhane et purifié par chromatographie sur colonne d'alumine (activité III, éluant: dichlorométhane puis acétate d'éthyle). 250 mg d'un solide jaune du compose 15 (R = 63%). *H-NMR (300 MHz, CDCh) δ (ppm) = 8.00 ppm (d, 3 = 1 Hz, 1H), 7.99 (d, J = 1 Hz, 1H), 7.89 (d, J = 1 Hz, 1H), 7.72 (d, J = 1 Hz, 1H), 3.99 (m, 10 H), 3.39 (m, 4H), 3.03 (m, 4H), 2.67 (m, 4H), 1.48 (s, 9H). LC-MS: [M+H]+ = 596.2 m/z. B5) Préparation du composé 16
    A une solution de 110 mg de composé 15 dans 60 mL de dichlométhane, on ajoute 3 mL d'acide trifluoroacétîque. Le mélange est ensuite agité pendant 12h à température ambiante. Le solvant est ensuite évaporé ainsi que le TFA par plusieurs ajouts d'un mélange méthanol/toluène. Le résidu est ensuite repris par 50 mL de dichlorométhane et lavé à l'eau jusqu'à pH = 7. La phase organique est ensuite séchée sur Na2S02 et évaporée pour obtenir 100 mg de poudre blanche du composé 16. (R = 95%). ^-NMR (300 MHz, CDCI3) δ (ppm) = 7.97 (d, J = 1 Hz, 2H), 7.54 (d, J = 1 Hz, 2H), 4.04 (s, 6H), 4.03 (s, 4H), 3.35 (m, 4H), 3.00 (m, 4H), 2.76 (s, 4H). 13C-NMR (75 MHz, CDC13) δ (ppm) = 163.91, 160 (q, J = 40 Hz), 147.58, 146.99, 126.49, 125.22, 60.37, 53.80, 53.56, 53.28, 45.39. HR-MS: [M+Hf = 496.1501 m/z, théor. pour C22H28O2.IM.4O4 is 496.1513 m/z. B6) Préparation du complexe 17
    100 mg de composé" 16"(0,2 mmol, 1 eq) sont'mis en suspension: dans"30'mL d'eau et 32 mg d'hydroxyde de sodium (0,81 mmol, 4 eq) sont ajoutés. Le"mélange est ensuite agité à: '60°C pendant lh. L'hydrolyse complète 'des'fonctions " ester" est confirmée par LC-MS. La solution est ensuite'refroidie et son p'H est ajusté à. 5 avec un ajout progressif d'une solution d'acide chlorhydrique (IM). 5 mi de méthanol sont ensuite ajoutés avant d'introduire 42 mg de carbonate de sodium à la solution.'91 mg de TbCl3» 6H20 sont ajoutés avant d'agiter le mélange à 50°C pendant 12h. Après retour à température ambiante, les sels insolubles sont filtrés sur verre fritté avant évaporation des solvants pour obtenir 300 mg de produit brut. Le complexe est purifié par chromatographie d'exclusion stérique (Sephadex® LH20, éluant : eau) pour finalement obtenir 55 mg d'un produit cristallin incolore (rendement = 44%). 1H-NMR (300 MHz, D20) δ (ppm) = 121.1, 83.90, 69.15, 52.71, 46.23, 29.58, 26.06, -0.96, -11.39, -20.2, -33.57, -36.26, -44.20, -70.35, -91.19, -92.47, -120.84. HR-MS: M+ = 624.0213 m/z, théor. pour C2oH2iCI2N504Tb 624.0219 m/z. C) Préparation d'une troisième série de ligands à base de triazacyclononane (TACN)
    CO Préparation du composé 19
    8,3 g de composé 12 (36 mmol, 1 éq.) sont dissouts dans 200 mL d'acétonitrile et 54 g d'iodure de sodium sont ajoutés (0,36 mol, 10 éq.) ainsi que 10 mL de chlorure d'acétyle (0,108 mol, 3 éq.). La suspension est ensuite placée dans un bain à ultrasons pendant 3h. Puis, 200 mL de dichlorométhane sont ajoutés et la phase organique est lavée avec une solution saturée d'hydrogénocarbonate de sodium. La phase organique est ensuite lavée à l'eau Jusqu'à pH = 7, séchée sur sulfate de sodium et évaporée pour obtenir 10,7 g de solide bianc cassé du composé 19, utilisé sans autre purification (R = 92 %). ^-WMR (300 MHz, CDC13) δ (ppm) = 8.65 (s, 2H), 4.02 (s, 6H). C2) Préparation du composé 20
    A une solution de 10,7 g (33,3 mmoi, 1 éq.) de composé 19 dans 200 ml d'un mélange méthanol/dichiorométhane (140/60) et refroidie à 0°C, 1,39 g de borohydrure de sodium (36,6 moi, 1,1 éq.) est ajouté. Le mélange est ensuite agité pendant 30 min à 0°C et 30 min à la température ambiante. La réaction est ensuite stoppée par ajout de 50 mL d'une solution d'acide chlorhydrique (IM). La phase organique est ensuite lavée à l'eau jusqu'à pH = 7, séchée sur Na2S04 et évaporée. Le produit brut est ensuite purifié sur gel de silice (éluant : dichlorométhane avec ajout progressif de méthanol (0 à 10%)) pour obtenir 5 g d'une poudre blanche du composé 20. (R = 51%). lH-NMR (300 MHz, CDCfe) δ (ppm) = 8.39 (bd, 1H), 7.97 (bd, 1H), 4.82 (d, J = 5 Hz, 2.H), 3.99 (s, 3H) 3.04 (t, J = 7 Hz, 1H). C3) Préparation du composé 21
    A une solution de 1 g de composé 20 (3,4 mmol, 1 éq.) et de 1,4 mL de triéthylamine (10,2 mmol, 3 éq.) dans 120 mL de dichlorométhane sont ajoutés 0,4 mL de chlorure de mésyle (5,1 mmol, 1,5 éq.). Après 30 minutes d'agitation (réaction suivie par CCM), 100 mL d'une solution saturée de'WaHC03 sont ajoutés. La phase organique est ensuite lavée à l'eau, séchée sur Na2S04 et évaporée. 1,1 g d'huile jaune du composé 21 est obtenue et utilisée sans autre purification (R = 95%). iH-NMR (300 MHz, CDCI3) δ (ppm) = 8.48 (s, 1H), 8.04 (s, 1H), 5.38 (s, 2H), 4.00 (s, 3H), 3.16 (s, 3H). Γ41 Préparation du composé 22
    60 mg de triazacyclononane mono-boc 6 (0,2 mmol, 1 éq.) sont mis en suspension dans 50 ml d'acétonitrile sec sous argon avec 140 mg de ia2C03 anhydre (1,2 mmol, 6 éq.). Une solution de 184 mg de composé 21 (0,5 mmol, 2,5 éq.) dans de l'acétonitrile sec est ensuite ajoutée et le mélange est agité pendant 12h à 60°C sous argon. Après refroidissement, le mélange est filtré sur fritté et évaporé. Le résidu est repris par du dichlorométhane et purifié sur colonne d'alumine (activité III ; éluant : dichlorométhane puis acétate d'éthyle).On obtient 110 mg de composé pur 22 sous forme de solide blanc pâteux (R = 71 %). ^-NMR (300 MHz, CDCb) δ (ppm) = 8.34 (s, 2H), 8.22 (s, 1H), 8.11 (s, 1H), 3.97 (s, 6H), 3.94 (s, 4H), 3.4-2.58 (m, 12 H), 1.47 (s, 9H). UC-NMR (75 MHz, CDCb) δ (ppm) = 164.6, 162 (d, .3 = 14 Hz), 155.61, 147.6 (d, 3 = 14 Hz), 135.3 (d, 3 = 14 Hz), 132.7, 106.6, 79.5, 63.1, 56.6, 54.9, 54.4, 53.1, 50.8, 50.2, 28.7. LC-MS: [M+Hf = 780.0 m/z. C51 Préparation du composé 23
    110 mg de composé 22 (0,14 mmol, 1 éq.) sont dissouts dans 50 mL de dichlorométhane, puis un excès d'acide trifluoroacétique est ajouté (3 mL). Le mélange est ensuite agité à température ambiante pendant 12 h. Le solvant est ensuite évaporé et un mélange de 20 mL de dichlorométhane et de 10 mL d'eau est ajouté. La phase aqueuse est neutralisée par ajout d'une solution saturée de NaHC03 et extraite avec du dichlorométhane. L'ensemble des phases organiques est séché sur sulfate de sodium et évaporé. On obtient 100 mg de solide blanc (rendement quantitatif) du composé 23 qui est utilisé sans autre purification. lH-NMR (300 MHz, CPCI3) δ (ppm) = 8.23 (s, 2H), 7.83 (s, 2H), 3.92 (s, 10H), 3.27 (s, 4H), 2.92 (s, 4H), 2.67 (s, 4H). 13C-NMR (75 MHz, CDCt3) δ (ppm) = 164, 159.98, 147.81, 134.86, 133.14, 107.08, 59.85, 53.36, 52.65, 49.87, 45.33. HR-MS: [M+H]+ = 680 m/z, théor. pour C22I2H28N2O5 680.0225 m/z. C6) Préparation du complexe 24
    100 mg de composé 23 (0,15 mmol, 1 eq) sont mis en suspension'dans 30 mL d'eau et 24 mg d'hydroxyde de sodium (0,81 mmol, 4 eq) sont ajoutés. Le mélange est ensuite agité à 60°C pendant Ih. L'hydrolyse complète des fonctions ester est confirmée par LC-MS. La solution est ensuite refroidie et son pH est ajusté à 5 avec un ajout progressif d'une solution d'acide chlorhydrique (IM). 5 mL de méthanol sont ensuite ajoutés avant d'introduire 42 mg de carbonate de sodium à la solution. 66 mg de TbCl3, 6H20 (0,18 mmol, 1,2 eq) sont ajoutés avant d'agiter le mélange à 50°C pendant 12h. Après retour à température ambiante, les sels insolubles sont filtrés sur verre fritté avant évaporation des solvants pour obtenir 200 mg de produit brut. Le complexe est purifié par chromatographie d'exclusion stérique (Sephadex® LH20, éluant : eau) pour finalement obtenir 36 mg d'un produit cristallin incolore (rendement = 30%). ‘H-WMR (300 MHz, D20) δ (ppm) = 122.8, 84.95., 82.17, 70.62, 49.22, 25.03, 20.8, -0.89, -8.54, -19.41, -33.05, -41.19, -67.6, -88.49, -90.57, -125.1. HR-MS: [M+Hf = 807.8921 m/z, théor. pour CzoHziIzNsC^Tb 807.8931 m/z. D) Préparation d'une quatrième série de ligands à base de triazacydononane (TACN)
    DU Préparation du composé 25
    1 g de composé 2 (6 mmol, 1 éq.) est dissout dans 100 ml de rnéthanol et 8 ml d'un solution aqueuse d'ammoniaque à 30% (60 mmol, 10 éq.). Ce mélange est agité à température ambiante pendant 12 h. Les solvants sont ensuite évaporés, jusqu'à obtenir 900 mg d'un solide blanc du composé 25 pur (R = quantitative). ^-NMR (300 MHz, CzDeSO) δ (ppm) = 8.14 (bs, 1H), 7.96 (t, J = 8 Hz, 1H), 7.88 (d, J = 8 Hz, 1H), 7.61 (bd, 1 = 8 Hz, 2H), 4.64 (s, 2H). LC-MS: [M+H]+ = 153.2 m/z. D2) Préparation du composé 26
    A 1 g de composé 25 (6,6 mmoi, 1 éq.) dans 20 ml de DMF à 0°C, 4 ml de chlorure de thionyie (53 mmol, 8 éq.) sont ajoutés. Le mélange est agité pendant 2h, avant de le laissé revenir à température ambiante en 15 min. 150 mL d'eau sont ensuite ajoutés, avant d'extraire te produit avec 30 mL de dîchlorométhane. La phase organique est ensuite lavée à l'eau jusqu'à atteindre un pH = 7, puis lavée à la saumure, séchée sur [ia2S04 et évaporée. Le résidu obtenu est. purifié par chromatographie sur gel de silice (éluant : dîchlorométhane) et conduit à l'obtention de 720 mg d'un solide blanc du composé 26 (R = 55%). XH-NMR (300 MHz, CDCh) δ (ppm) = 7.89 (t, J = 8 Hz, 1H), 7.75 (d, J = 8 Hz, 1H), 7.65 (d, J = 8 Hz, 1H), 4.69 (s, 2H). LC-MS: [M+H]+ = 153.3. D3) Préparation du composé 27
    120 mg de triazayclononane protégé par un mono-Boc (0,4 mmol, 1 éq.) sont dissouts dans 50 mL d'acétonitrile sec sous argon avec 252 mg de Na2C03 anhydre (2,4 mmol, 6 éq.). Une solution de 151 mg de composé 26 (1 mmol, 2,5 éq.) dans de l'acétonitrile sec est ensuite ajoutée et le mélange est agité pendant 12h à 60°C sous argon. Après refroidissement, le mélange est filtré sur fritté et évaporé. Le résidu est repris par du dichlorométhane et purifié sur colonne d'alumine (activité III ; éluant : dichlorométhane puis acétate d'éthyle).On obtient 160 mg de composé 27 sous forme de solide blanc pâteux (R = 83 %). *H-NMR {300 MHz, CPC13) δ (ppnn) = 7.79 (dt, 3J = 8 Hz, 4J = 1 Hz, 2H), 7.70 { bd, J = 8 Hz, 2H), 7.57 (dt, 3J = 8 Hz, 4J = 1 Hz, 2H), 3.91 (s, 4H), 3.36 (m, 4H), 3.03 (m, 4H), 2.66 (m, 4H), 1.47 (s, 9H). LC-MS: [M+Hf = 462.2 m/z. D4) Préparation du composé 28
    A une solution de 160 mg du composé 27 (0,35 mmot, 1 éq.) dans 40 ml de DMF sec sous argon, 225 mg de NaN3 (3,5 mmol, 10 éq,) et 185 mg de NH4CI sec sont ajoutés. Le mélange est agité à reflux à 120°C pendant 12 h. Après refroidissement, filtration sur fritté et évaporation des solvants, un résidu est obtenu, qui est repris par 50 mL d'acide chlorhydrique (IM) et mis dans un bain à ultrasons pendant 2h. HR-MS [M+H+] : 604.1439 th 604.1447 D5) Préparation du composé 29
    155 mg de composé 28 (0.35 mmol, 1 eq) sont mis en suspension dans lOmL d'eau avec 220 mg de Na2C03 (2.08 mmol, 6 eq). Après 10 min d'agitation, 155 mg de TbCl3*6H20 (0.42 mmol, 1.2 eq) sont ajoutés. La solution est ensuite agitée 12h à température ambiante. Après évaporation des solvants, le produit brut est purifié sur une colonne d'exclusion stérique. (Sephadex ® LH20 dans l'eau) pour finalement obtenir 40 mg de solide blanc cristallin (rendement = 20 %). HR-MS: [M+H]+ = 604.1439 m/z, théor pour C2oH23NoTb 604.1427 m/z. E) Préparation d'une première série de ligands à base de 1,7-ΰϊοχ3-4,10-diazacyclododecane
    Le composé 31' est préparé selon la méthode précédemment reportée (M. Mato-Iglesias, Adrién Roca-Sabio, Z. Pélinkés, D. Esteban-Gomez, C. Platas-Iglesias, E. Tôth, A. de Blas, T. Rodrtguez-Bîas, Inorg. Chem., 2008, 47, 7840).
    Partie II : Etudes cristallographiques A) Protéines modèles étudiées 5 protéines, dont trois protéines commerciales ont été sélectionnées. La structure de ces cinq protéines était connue. Ces cinq protéines ont été choisies en raison de leurs différences physico-chimiques. En effet, elles appartiennent à des organismes variés, présentent des propriétés thermiques larges et un état oligomérique allant du monomère à i'hexamère, Des tests, avec des protéines dont la structure est inconnue, ont également été réalisés, a. Protéines commerciales
    Les trois protéines commerciales sélectionnées sont le lysozyme de. blanc d'œuf de poule (HEWL), ta Thaumatîne de Thaumatococcus danielti et la Protéinase K de Tritirachium album. Ces trois protéines sont des protéines modèles en matière de cristallogenèse. Elles sont achetées sous forme lyophilisée. Elles ont été solubilisées dans de l'eau milliQ juste: avant les expériences de cristallogenèse à la concentration souhaitée. Elles sont présentées dans le Tableau 1 ci-après.
    Tableau 1 : Protéines commerciales utilisées et fournisseur associé
    Les conditions de cristallisation native (c'est-à-dire sans ajout de complexe selon l'invention) de ces protéines sont connues et décrites dans le Tableau 2 ci-après. Ces conditions ont été reprises pour caractériser l'effet des complexes de lanthanide selon l'invention, sur la cristallogenèse de ces protéines commerciales.
    Tableau 2 : Conditions de cristallisation usuelles des protéines commerciales a. Protéines non-commerciales
    Les deux protéines non-commerciales (structures connues) sont la Protéase 1 de Pyrococcus horikoshii et la Glyoxylate hydroxypyuvate réductase de Pyrococcus furiosus. Ces deux protéines ont été purifiées selon les protocoles décrits dans les réferences ci-dessous : - Protocole..de .purification de..la. protéine Protéase 1 de. P, horikoshii ; Xinlin Du et al. Crystai structure of an intracellular protéase from Pyrococcus horikoshii at 2-A résolution. 2000. Vol97. N° 26. PNA8. - Protocole de purification de la protéine Glyoxylate réductase de P. furiosus : Thèse de Louise Lassa lie, soutenue le 19 Décembre 2014 à Grenoble : Bases moléculaires de l'adaptation piézophiie : études structurales et biochimiques d'enzymes clés du métabolisme provenant d'archées et de bactéries isolées dans les fonds marins. Lien : htto:/./www.theses.fr/s98711.
    Les détails techniques concernant ces protéines sont donnés dans le Tableau 3 ci-après :
    Tableau 3 ; Caractéristiques des protéines non commerciales utilisées Séquence de la GRHPR : SEQ ID N°4 Séquence de la Protéase 1 : SEQ ID N°5
    Les conditions de cristallisation de ces deux protéines sont décrites dans le Tableau 4 ci-après. Ces conditions permettent de cristalliser les protéines sous leur forme native et sont extraites des mêmes références que les protocoles de purification.
    Tableau 4 : Conditions de cristallisation des protéines non commerciales utilisées Les cinq protéines décrites ci-dessus sont les protéines de référence pour caractériser les effets des complexes de lanthanide. c. Protéines inconnues
    Les spécificités des trois protéines dont la structure est inconnue sont décrites dans le Tableau 5 ci-après. La structure de la protéine MDH-ANC80 a été déterminée grâce au complexe de lanthanide 17. Les différentes étapes seront décrites de manière individuelle dans un paragraphe dédié,
    Tableau 5 : Caractéristiques des protéines de structure inconnue sur lesquelles les complexes de lanthanide selon l'invention ont été testés Séquence de la Pb6 : SEQ ID N°6 Séquence de la MDH : SEQ ID N°7
    Aucune condition de cristallisation n'était publiée concernant ces deux protéines.
    Le protocole de purification de la malate déshydrogénase (MDH) de l'ANCSO est décrit dans la littérature (Madem et al, 1995 230(3):1088-95 Eur. 3. Biochem).
    Le protocole de purification de pb6 a été établi par l'équipe de Cécile Breyton du groupe M&P de l'Institut de Biologie Structurale et est le suivant :
    Protocole de·.purification: de ob6 :
    Système d'expression = E. colt BL21(DE3) transformé avec LIM1 (Kan R) His tag avec site de clivage « Tobacco Etch Virus ». - Préculture milieu LB classique avec 50 pg/mi de kanamicyne - Culture en milieu classique LB : Ensemencement avec une densité optique de 0.1 et 50 pg/mi de Kanamicyne. -Après 6 heures de culture, centrifugation 30 minutes 4000rpm
    - Congélation des bactéries a -80 °C - Cassage - Reprise dans du tampon de lyse 50mM Tris pH 8, 150mM NaCl, 2mM MgCI2 en précence d'anti-protéase et DNase - Lyse des bactéries au mîcro-fluidizer 6x 12000psi - Centrifugation : 20 minutes à 14 000 rpm - Colonne d'affinité nickel
    Tampon d'équilibration = 20 mM Tris pH 8, 250 mM NaCl, 15 mM Imidazole
    Tampon d'élution = 20 mMTris pH 8, 200 mM Imidazole Débit = Iml/mîn - Dilution des fractions d'élutions au cinquième avec de l'eau distillée pour diminuer la conductimétrie. - Colonne échangeuse d'ions (HT Q lml)
    Tampon d'équilibration = 20 mM Tris pH 8 Tampon d'élution = 20 mM Tris pH 8 IM NaCI Elution par gradient linéaire Débit = lml/min - Concentration sur concentrateur ayant une membrane de 30kDa - Dessalage par gel filtration dans un tampon tris pH 8 20 Mm B) Cristallisation automatisée/Stabitité des complexes de lanthanide a. La plateforme HTXIab.
    Afin de déterminer tes conditions de cristallisation d'une protéine, la plateforme HTXIab permettant de cribler un large panel de conditions de cristallisation a été utilisée. Ces conditions sont toutes décrites dans les Tableaux figurant en Annexe 2A et 2B et issus de https://embl.fr/htxlab/index, php GptiQn=comj:ontent&vîew=artide&id=38Mter™d= 172. ^ · ·
    Un criblage classique est constitué de 6 plaques de cristallisation de 96 puits chacune, soit 576 conditions.
    Les études réalisées sur les protéines MDH-ANC80 et Pb6 ont utilisé les conditions décrites en Annexe 2A.
    Les études réalisées sur les autres protéines ont été réalisées avec les conditions décrites en Annexe 2B, du fait d'un changement dû au fournisseur. Stabilité des complexes
    Les études de stabilité ont été réalisées avec les conditions décrites en Annexe 2A. Il a été montré que les complexes de lanthanide basés sur le tris-dipicoiinate (DPA) [Ln(DPA)3]3' présentaient une « auto-cristallisation » pour certaines conditions de cristallisation. En particulier, la présence de cations divalents, de fortes concentrations en sels, la présence de MPD provoquait i'auto-cristallisation de ce type de complexe (Thèse de doctorat de R. Talon soutenue à Grenoble le 6 juin 2012). Deux concentrations de Ln(DPA)33' ont été évaluées (25 et 100 mM). Ainsi, sur 576 conditions, plus d'un quart des conditions conduisent à une auto-cristallisation/formation de précipités du Ln(DPA)33' à 100 mM et de l'ordre de 8% lorsqu'il est utilisé à 25 mM.
    De manière équivalente, la stabilité du complexe 10 a été évaluée à 3 concentrations différentes (10, 50 et 100 mM). Le complexe 10, même à une concentration de 100 mM, présente une stabilité accrue. En effet, aucun cristal du complexe n'a été observé, comme détaillé ci-dessous où seule la présence de précipités a été détectée. Récapitulatif du criblage des 6 plaques classique pour 100 mM de complexe 10 : Plaque Hampton 3 Légères précipitations observées en présence de NaHP04ou KHP04.
    Plaque Hampton 5
    Majoritairement des PEGs dans ce cas 100 % des gouttes sont claires.
    Plaque Hampton 4
    Majoritairement des sels. Quelques conditions sont redondantes avec ta plaque Hampton 3. Effet similaire en présence de HP04' avec de légères précipitations observées.
    Plaque Qiagen 1 Mélange PEGs, sels et métaux. Un léger précipité est observé en présence d'acétate de cadmium.
    Plaque Hampton 6 Léger précipité observé en présence d'un mélange de métaux (cadmium, zinc, cobalt).
    Plaque Hampton 2 Léger précipité en présence de NaF et de (NH4)2P04 Ci-dessous le détail des conditions qui conduisent à ces précipités :
    Avec 100 mM de complexe 10 ajoutés aux conditions dassiques :
    Plaque Hampton 4 : 21 conditions précipitées n° A7, B7, C7, A8, B8, ABCD 9, 10,11 et 12 (majoritairement phosphate d’ammonium)
    Plaque Hampton 5 : Aucun précipité
    Plaque Quiagen 1 : 6 conditions précipitées n° D6, B9, F9, F9, D10, E10
    Plaque Hampton 6: 4 conditions précipitées n° A3, B3, C3, H8
    Plaque Hampton 2 : 7 conditions précipitées n° Cl, C5, B6, kl, Cl, kll, B12
    Plaque Hampton 3 : 4 conditions précipitées n° H3, E4, A6, E5
    Soit un total de 42 conditions présentant des précipités. Sur un criblage de 576 conditions cela équivaut à 7,3 % ;
    Aucun faux positif comme avec le DPA.
    Avec 10 mM de complexe 10 ajoutés aux conditions classiques:
    Plaque Hampton 4 : Aucun précipité marqué comme observé avec 100 mM quelque trace de précipité pour ABCD ligne 12
    Plaque Qiagen 1 : E10 une condition légèrement précipitée
    Plaque wizard I et II rigaku 5 conditions précipitées n° E6, C7, B9, CIO, Hll
    Plaque JCSG : 3 conditions légèrement précipitées n° D2 G5, A6
    Plaque PACT Qiagen : 5 conditions précipitées n° El, Â5, A6, Eli, C12
    Plaque PEGs Qiagen : Aucune condition précipitées
    Soit un total de 18 conditions présentant de légères traces de précipités. (3,2% du criblage) sachant que' des gouttes avec quelques traces de précipité ont été qualifiées de « précipité ». La quantité et le nombre d'essais entraînant des précipités n'ont rien à voir avec les précipités observés à 100 mM de complexe 10, ni à 25 mM de Ln(DPA)33~.
    Il est à noter que la présence de ces précipités n'est pas incompatible avec l'apparition de cristaux de protéine. En effet, des essais de cristallisations manuelles de la protéine MDH de C. aurantiacus en présence de cadmium ont permis d'obtenir des cristaux en présence de 50 mM de complexe 10. C) Criblage de nouvelles conditions de cristallisation
    Pour réaliser un criblage de six plaques sur la plateforme HTXIab, 100 pl de solution de protéine sont nécessaires. Afin de disposer d'une comparaison directe, la protéine native (sans complexe de ianthanide) et la protéine en présence de 10 mM de complexe 10 ont été criblées en parallèle dans les mêmes plaques de cristallisation. a. Protocole de préparation des échantillons protéiques contenant le complex ede lanthanide.
    Les complexes de lanthanide ont été stockés sous forme de poudre à 4°C. La masse correspondant à 10 mM pour 100 μΙ de solution de protéine a été pesée sur une balance de précision. La poudre a été centrifugée pour former un culot. Ce culot a été repris par 100 μΙ de la solution de protéine. Une centrifugation de deux minutes a été réalisée pour éliminer les éventuels agrégats. La solution a ensuite été changée de tube. Ce protocole a été appliqué pour l'ensemble des protéines envoyées au robot. b. Détermination de nouvelles condition pour la protéine inconnue ob6
    Les conditions les plus intéressantes en terme de cristallogenèse et permettant la cristallisation de pb6 sont répertoriés dans le tableau 6. Les conditions ayant permis la formation de cristaux uniquement en présence de 10 mM de complexe 10 sont mentionnées en gras (il s'agit de pb6-l et pb6-4).
    Tableau 6 : Conditions de cristallisation pour la protéine pb6 obtenues au robot HTX en absence ou en présence de complexe 10
    La condition pb6-l a été reproduite manuellement en laboratoire et a également donné des cristaux. L'utilisation des complexes selon l'invention permet de doubler le nombre de conditions ayant conduit à une cristallisation. c. Détermination de nouvelles condition pour la protéine inconnue MDH-ANC80 Les conditions les plus intéressantes en terme de cristallogenèse et permettant la cristallisation de la protéine ANC80 sont répertoriés dans le tableau 7,
    Les conditions ayant permis la genèse de cristaux uniquement en présence de 10 mM de complexe 10 sont mentionnées en gras (il s'agit de ANC-1 et ANC-2).
    Tableau 7 : Conditions de cristallisation pour la protéine ANC8Ô obtenues au robot HTX en absence ou en présence de complexe 10
    La condition ANC-1 a été reproduite au laboratoire et a permis la croissance de cristaux (Paragraphe D.a). L'utilisation des complexes selon l'invention permet de tripler le nombre de conditions ayant conduit à une cristallisation, d. Statistiques d'obtention des cristaux des différentes protéines étudiées sur la plateforme HTXIab
    Dans le Tableau 8 ci-après, est présenté le nombre de conditions ayant conduit à des cristaux après un criblage classique (de 576 conditions commerciales pour le complexe 10 et de 480 pour le complexe 31) sur la plateforme HTXIab des différentes protéines étudiées. Les valeurs indiquées correspondent à une observation des plaques de cristallisation après 85 jours. La colonne « conditions uniques » correspond au nombre de conditions qui entraînent une cristallisation en présence de complexe, mais aucune cristallisation dans les mêmes conditions en l'absence de complexe (dites natives).
    Tableau 8 * Condition ayant conduit à cristallisation en l'absence de complexe (conditions natives) ** Condition ayant conduit à cristallisation avec ajout de complexe
    Les conditions conduisant à une cristallisation correspondent à des conditions conduisant à l'apparition de cristaux potentiellement exploitables pour des expériences de diffraction. Ainsi, le complexe 10 permet l'augmentation significative du nombre de conditions de cristallisation pour les protéines suivantes : HEWL et Pho protéasel. Si son effet peut paraître moins efficace dans le cas des protéines
    Protéinase K et Thaumatine, il n'en est rien. En effet, l'introduction du complexe 10 ne conduit pas à une augmentation importante du nombre de hits ianthanide, mais les conditions obtenues sont en grande partie différentes des conditions natives (21 pour Protéinase K et 2 pour Thaumatine). On augmente donc le nombre de conditions potentielles permettant d'obtenir des cristaux de la protéine d'intérêt.
    Il est à noter que dans le cas de la protéine Protéasel avec le complexe 10, l'obtention de 113 conditions couvre une large gamme de conditions de cristallisation différentes. Cela prouve à nouveau que le complexe 10 est compatible avec l'ensemble des conditions physico-chimiques que l'on peut rencontrer dans les kits de cristallisation commerciaux.
    Le complexe 10, comme les complexes 17 et 31, possèdent tous trois un caractère nucléant. Cependant, les complexes 17 et 31 sont moins efficaces que le complexe 10. A titre d'exemple, le complexe 31 semble moins efficace que le complexe 10 pour la protéinase K. Cependant, les 4 conditions ayant conduit à cristallisation, en présence du complexe 31, sont différentes de celles ayant conduit à des cristaux natifs. Ces cristaux sont potentiellement de meilleure qualité. Le fait d'obtenir de nouvelles conditions conduisant à une cristallisation est donc une avancée. D) Cristallisations réalisées manuellement en laboratoire
    Les protéines commerciales (Paragraphe A.a), ont été cristallisées manuellement selon les conditions de cristallisation usuelles connues (Tableau 2). Les conditions de cristallisation décrites dans le Tableau 2 ont donc été reproduites en présence de complexes 10 ou 17 à une concentration de 10 mM. Pour réaliser ces gammes de cristallisation manuelles, les gouttes de cristallisation ont été préparées selon le schéma suivant : 1,5μΙ de solution de protéine + l,5pl de solution de complexe à une concentration de 10 mM + l,5pl de solution de précipitant. Afin de mettre en avant un potentiel effet des complexes de Ianthanide sur la cristallisation, la gamme en agent précipitant a été ajustée de manière à se trouver en limite de la zone de cristallisation, puis, éventuellement étendue au-delà lorsqu'un effet était observé.
    Ainsi, dans le cas de ta protéine lysozyme, un effet nucléant marqué a été observé. L'effet nucléant doit ici être entendu par la croissance de cristaux en présence du complexe de lanthanide à des concentrations en précipitant faible, concentrations qui ne permettent pas la formation de cristaux natifs. Afin de mettre clairement en évidence ce phénomène de nucléation induit par les complexes selon l'invention, des diagrammes de phase ont été réalisés en déterminant les gammes de concentration en agents précipitant et en protéine qui permettent l'obtention de cristaux. a. Diagrammes de phase pour le lysozyme de blanc d'œuf de poule natif et en présence de 10 mM de complexe 10 ou de complexe 17
    Les diagrammes de phase de la protéine lysozyme obtenus après 2 jours et 15 jours de croissance sont représentés Figure 5 :
    Chaque condition de cristallisation a été réalisée en triplicata. Après seulement deux jours de croissance cristalline, une nette différence a été observée. En présence du complexe 10 ou 17, des cristaux ont été obtenus à de faibles concentrations en protéine (5 mg/ml) et en précipitant
    Après 20 jours de croissance cristalline en présence de complexe 10 ou 17 à 10 mM, des cristaux ont été obtenus sur l'ensemble de la gamme évaluée. En particulier, des cristaux sont apparus pour 5mg/ml de lysozyme et pour une concentration en précipitant de.500.mM. Par comparaison, l'absence de complexe de lanthanide permet seulement la formation de cristaux jusqu'à 500 mM de NaCI et pour des concentrations de 20 mg/ml de protéine. A titre de comparaison :
    Les complexes de type IRM, qui n'induisent pas d’effets nucléants, sont classiquement utilisés à des concentrations de l'ordre de 50-300 mM. - Le tris-dïpîcolînate de lanthanide a.produit une nouvelle.forme cristalline du ... lysozyme seulement lorsqu'il a été utilisé à des concentrations supérieures à 50 mM. - Les MIPs proposées par IMaomï E. Chayen (Saridakis, E., Khurshîd, S., Govada, L., Phan, Q., Hawkins, D., Crichlow, G. V., Lolis, E., Reddy, S, M., & Chayen, N. E. (2011). Proceedings of the National Academy of Sciences. 108, 11081-11086) conduisent à des décalages de la zone de cristallisation de seulement une à deux unités de concentration en agents précipitant. Les effets nucléants associés ne sont obtenus que pour des concentrations conventionnelles de lysozyme de l'ordre de 30 mg/ml (Khurshid et al., Automating the application of smart materials for protein crystallîzatîon, (2014) Acta cryst D). Selon Saridakîs et al. (Saridakîs, E., Khurshid, S., Govada, l., Phan, Q., Hawkins, D., Crichlow, G. V., Lolis, E., Reddy, S. M., & Chayen, N. E. (2011). Proceedings of the National Academy of Sciences. 108, 11081-11086.), la gamme de cristallisation du lysozyme en présence de leurs agents nucléants débute à partir de 480 mM de NaCI et ce, pour une concentration en protéine de 20 mg/mL. Aucun cristal de lysozyme n'a été observé en dessous de 460 mM NaCI. Concernant la protéine thaumatine (30 mg/ml) aucun cristal n'est observé en dessous de 0,2 M tartrate. En présence de leurs agents nucléants, ils obtiennent des cristaux pour 0,3 et 0,4 M tartrate (idem complexe 10) et des cristaux natifs pour 0,5 M tartrate. - Les complexes de type POM ne présentent d'effet nucléant qu'avec des concentrations élevées de lysozyme (de l'ordre de 100 mg/ml), ce qui pose des problèmes de solubilité pour la plupart des protéines. (A. Bijelic et al Hen Egg-White Lysozyme Crystallisation: Protein Stacking and Structure Stability Enhanced by a Tellurîum(VI)-Centred Polyoxotungstate ChemBioChem 2015, 16, 233-241). b. Diagramme de phase pour le Ivsozvme de blanc d'œuf de poule natif et en présence de 10 mM de complexe 11 (Eu)
    Le diagramme de phase obtenu en présence du complexe 11 (Figure 6) est équivalent à celui obtenu en présence du complexe 10. La nature du îanthanide présent au sein du complexe n'influence pas l'effet nucléant observé. c. Diagrammes de phase pour la protéine de-structure inconnue ob6
    La protéine pb6 a été purifiée selon le protocole décrit précédemment. La condition pb6-l (Paragraphe Cb) obtenue au robot HTXIab a été reproduite manuellement. Des diagrammes de phases ont été déterminés. Ils sont représentés sur la Figure 7. Comme pour le lysozyme, l'effet nucléant est très important. Les cristaux obtenus en présence du complexe de Ianthanide selon l'invention sont très prometteurs (voir Figure 8) pour une étude cristallographique.
    Les cristaux obtenus en presence de lu mM de complexe lu sont parfaitement exploitables pour des expériences de diffraction. Les cristaux natifs sont trop petits, trop fins et mal organisés. Ainsi dans le cas de la protéine pb6, on observe à la fois un effet nucléant et cristallisant induit par le composé 10, d. Effet cristallisant des complexes de lanthanide 10
    Si une amélioration de la cristallisation (nombre de cristaux, taille des cristaux, amélioration de la diffraction) est observée par l'ajout de complexe de lanthanide, on parle alors d'effet cristallisant
    Dans le cas de la cristallisation de la protéine Protease 1 de P. horikoshiî un effet cristallisant a également été observé lié à l'ajout du complexe 10. En effet, les cristaux obtenus en présence de 10 mM de complexe 10 sont apparus en moyenne 2,5 fois plus gros que les cristaux obtenus dans les mêmes conditions, mais sans complexe (taille moyenne évaluée sur. 10 cristaux présents dans une goutte photographiée).
    Cet effet cristallisant présente donc un intérêt certain pour la cristallographie aux rayons X puisque l'intensité diffractée est .proportionnelle au. volume de l'échantillon irradiée. Ceia peut ainsi permettre d'obtenir une résolution supérieure pour les données de diffraction. E) Propriétés de luminescence et applications
    Les complexes de coordinations du terbium et de l'europium (III) sont connus pour présenter des propriétés de luminescence très particulières, dues aux transitions f-f qui se traduisent par des raies d'émission fines et caractéristiques de chaque élément et des durées de vie longues (ps-ms). Il est difficile d'induire cette luminescence par irradiation directe de l'ion métallique, car ces transitions f-f sont interdites et présentent donc de très faibles coefficients d'absorption molaire. En revanche, il est possible de sensibiliser cette luminescence par un processus indirect, appelé effet d'antenne, et qui consiste à exciter un ligand organique contenant un chromophore (typiquement un groupement aromatique) et de transférer cette énergie sur l'ion métallique (Luminescence of Lanthanide Ions in Coordination Compounds and Nanomaterials, Ed. A. De Bettencourt-Dîas, Wiley 2014).
    Ces propriétés de luminescence des complexes de lanthanide proposes peuvent être mises à profit, lors de deux étapes de la détermination de la structure d'une protéine ; a) la détection des cristaux lors des cristallisations et b) durant le centrage des cristaux lors de l'expérience de diffraction. a. Détection des cristaux lors des cristallisations
    La détection des cristaux peut parfois être compliquée, par exemple lorsque les cristaux sont de petites tailles, sont noyés dans du précipité ou encore obtenus en bord de goutte de cristallisation. Dans le cas particulier des protéines membranaires, on peut aussi citer le problème de la détection des cristaux obtenus par la technique de cristallisation en phase cubique de lipides.
    Pour améliorer la détection des cristaux, de nombreux fournisseurs proposent des microscopes avec une source UV, permettant d'utiliser la fluorescence intrinsèque des acides aminés aromatiques, en particulier du tryptophane. A titre d'exemple, on peut citer la source UV proposée par Molecular Dimension (http://www.moleculardimensions.com/applications/upload/Xtalight_100.pdf) ou le microscope UVEX (http://www.moleculardimensîons.com/shopdisplayproducts.asp id=299&cat=UVEX+ UV+Fluorescence+Imaging+Systems) proposé par la même société. L'utilisation de la luminescence des complexes de lanthanide -peut contribuer à résoudre une grande partie des·problèmes cités auparavant.
    La luminescence des complexes de lanthanide selon l'invention a donc été étudiée, en utilisant une source UV en voie de commercialisation par la société NatXray sur un microscope classique et une source UV LED externe de la société OceanOptics (Figure 9 ; Longueur d'onde d'excitation 365 nm ; Modèle. LLS-365 ; http://oœanoptics.com/product/lls-family/) (cristaux de lysozyme obtenus en présence de IQmM du complexe 10 ou cristaux de la protéine MDH ANC80 obtenus en présence de 50mM de complexe 17). A l'aide du système de la société NatX-ray, les cristaux obtenus en absence du complexe 10 apparaissent de couleur bleue (à gauche). A l'inverse ceux obtenus avec ce complexe apparaissent de couleur verte (à droite) qui se traduit par une augmentation du contraste entre les cristaux et la solution· qui les entoure. Cela est également observable avec le système utilisant une source UV LED, puisque les cristaux, obtenus en présence du complexe 17 et sous illumination UV sont plus facilement identifiables que lorsqu'ils sont observés en lumière blanche. A titre d'exemple, un cristal de petite taille est indiqué par une flèche blanche (Figure 9).
    On remarquera en outre que la luminescence est observable pour deux longueurs d'onde d'excitation (280 nm et 365 nm). b. Aide au centrage des cristaux
    Cette partie a été évaluée à l'aide de l'instrument CRYOBENCH de l'IBS-ESRF (http://www.isbg.fr/analyses-structurales/crvObench/) et sur la ligne de lumière FIP-BM30A de l'ESRF.
    Les cristaux utilisés (cristaux de lysozyme obtenus en présence de lOmM du complexe 10 ou cristaux de la protéine MDH ÂNC8G obtenus en présence de 50mM de complexe 17) ont été congelés de manière classique à 100 K sur des boucles de nylon.
    Pour.,.prendre des photos, la même source UV .LEO· externe de ...la société OceanOptîcs a,, été. utilisée. La. qualité des photos obtenues ".permet d'envisager différents moyens de faciliter le centrage : - un centrage.direct grâce à la luminescence, - l'utilisation d'un spectrophotomètre pour mesurer précisément la luminescence et rechercher les zones présentant les intensités les plus fortes qui correspondraient à la présence d'un cristal. L'idée serait donc de scanner la boucle avec un faisceau UV assez fin. - Effectuer un pré-positionnement grâce à la luminescence, complété par un centrage précis par la technique dite de Raster scanning (Aishîma et al. Acta D (2010), D66, 1032-1035), notamment dans le cas des cristaux de petite taille ou de type aiguille fine. F) Potentiel phasant des complexes de lanthanide selon l'invention a. Méthodolooie utilisée L'évaluation du potentiel phasant des complexes de lanthanide selon l'invention a été effectuée de manière conventionnelle, en utilisant différentes méthodes de novo de détermination des phases, représentant un panel des techniques couramment utilisées pour la détermination des structures de macromolécules biologiques. Cela montre que l'utilisation des complexes selon l'invention permet une utilisation habituelle des méthodes de phasage.
    Les méthodes testées sont : • la méthode SAD, qui présente l'avantage de nécessiter un seul cristal et d'effectuer un seul enregistrement de diffraction, • la méthode MAD, qui présente l'avantage de nécessiter un seul cristal, qui suppose un enregistrement à plusieurs longueurs d'onde et qui produit théoriquement des phases de meilleure qualité que la méthode SAD, • la méthode SIRAS, qui suppose un enregistrement sur un cristal de la protéine en absence de complexe et un enregistrement sur un cristal de la protéine en présence de complexe. Cette méthode suppose un excellent isomorphisme des deux cristaux et donc nécessite qu'ils présentent la même forme cristalline.
    Les données de diffraction ont été intégrées et mises à l'échelle avec les programmes XDS, SCALA et TRUNCATE.
    Le programme AutoSharp (https://www.qlobalphasmo.com/sharp/Ya été utilisé. Ce programme effectue, de manière automatique, la recherche de la position des atomes lourds, leur affinement, la détermination initiale des phases, ainsi que leur amélioration. Le programme a été utilisé avec les paramètres par défaut. Le résultat du phasage est évalué sur la base des figures de mérite (FOM pour « Figure of Merit »), avant et après amélioration des phases...
    Dans un second temps, la qualité du phasage a été évaluée en effectuant une reconstruction automatique du modèle de la protéine considérée. On dispose, alors, du nombre de résidus modélisés sur le nombre de résidus .attendus. Le. programme Buccaneer (http://www.ccp4.ac.uk/dist/html/cbuccaneer.html).a:été.utilisé avec les paramètres par défaut et avec 10 cycles de reconstruction.
    En ce qui concerne l'obtention des données de diffraction, ces dernières ont été enregistrées de manière conventionnelle sur ligne de lumière.synchrotron...'.Afin de déterminer de manière précise le seuil d'absorption Lm du ianthanide utilisé, une mesure de fluorescence a été .effectuée et traitée à. l'aide du..programme Chooch (http://www.gwyndafevans.co.uK/chooch.html). Les longueurs d'onde d'enregistrement sont ainsi obtenues, afin d'exploiter de manière optimum Je., signal . anomal du Ianthanide (méthodes SAD et MAD). Dans le cas de la méthode SIRAS et en plus de l'enregistrement au seuil Lm du lanthanide sur le cristal dérivé, un enregistrement sur un cristal natif a été effectué à la longueur d'onde de 0,9798 Â. Les résultats sont présentés Figure 10,
    Pour chacune des méthodes de phasage évaluées, les enregistrements ont été effectués aux longueurs d'onde indiquées dans le Tableau 9 :
    Tableau 9: Méthodes de phasage utilisées et énergies d'enregistrement associées, b. Test de diffraction de protéines cristallisées en présence de 10 roM de complexe 10: ou 17
    Les cristaux des protéines co-cristallisées en. présence de 10"mM de complexe 10 ou 17 (Condition d'effet nucléant du complexe de lanthanide) ont été évalués en termes de diffraction. Les résultats de cette évaluation sont résumés dans le Tableau 10 :
    Tableau 10 : Résultats des tests de diffraction obtenus sur différentes protéines cristallisées en présence des complexes de lanthanide
    Dans le cas de la protéine Protéase 1, l'effet cristallisant se manifeste aussi bien-par une augmentation de "la taille moyenne des cristaux, comme indiqué précédemment, que par-la résolution Obtenue pour la diffraction. En effet, les données de diffraction enregistrées sur un cristal obtenu en présence de 10 mM de complexe 10· présentent une résolution de 1,7 Â. Le meilleur modèle· actuellement disponible dans la Protein Data Bank est à 2,0 Â (Code PDB : 1G2! Référence publication : idem protocole partie 1b). c. Phasaae de novo des protéines modèle Les structures des différentes protéines modèles ont été déterminées selon tes différentes méthodes 'explicitées dans le paragraphe F.a.
    En outre, les tentatives de phasage ont été effectuées sur des cristaux obtenus en conditions nuciéantes du complexe (c'est-à-dire à 10 mM), mais la possibilité d'effectuer un trempage d'un cristal obtenu en présence de 10 mM de complexe 10 ou 17 dans une solution similaire à la condition de cristallisation et contenant 100 mM de complexe de. lanthanide a également été étudiée. Ceci avait pour but d'augmenter éventuellement le taux de marquage de la. protéine et de faciliter ainsi ia détermination de la structure. Le temps de trempage'était de l'ordre de la minute. Il est à noter que cette technique de trempage'peut"·;aussi être appliquée à des cristaux'natifs (obtenus en absence de complexe de lanthanide).
    En résumé, les trois méthodes de préparation'des cristaux suivantes ont été évaluées· pour un phasage de-riovcren utilisant les complexes de lanthanide selon l'invention : - cristal ca'-cristàliisé en ' présence de de complexe (condition nucléante), - cristal co-cristallisé en présence de 10 mM de complexe et trempé dans une solution contenant 100 mM du même complexe, - cristal natif trempé dans une solution de 100 mM du complexe de lanthanide. L'ensemble des données de diffraction a été obtenu en accord avec la méthodologie explicitée au paragraphe F.a. Les résultats sont présentés dans le Tableau 11 ci-après.
    Tableau 11 : Résultats des phasage de novo pour les protéines modèles * Trempage : Dans une solution cryoprotectante contenant 100 mM de complexe
    Le haut pouvoir phasant des complexes objets de la présente invention se reflète dans le pourcentage de modèle reconstruit dans intervention manuelle. Plus la détermination des phases est de qualité (ce qui dépend de la méthode de phasage utilisée, de l'occupation des sites de fixation des complexes, de la qualité des données...) plus la carte de densité électronique expérimentale sera interprétable par les programmes de reconstruction automatique (tel que le programme Buccaneer). Dans les cas évalués, des modèles reconstruits automatiquement de l'ordre de 50% à pratiquement 100% du modèle final ont été obtenus. d. Exemples de densité électroniques obtenues après phasage et aplatissement de solvant
    Un exemple de densité électronique expérimentale obtenue selon les méthodes décrites précédemment pour la protéine glyoxylate réductase et pour la protéine Protéase 1 sont illustrées Figure 11. Les cristaux de glyoxylate réductase ont été obtenus selon les conditions décrites dans le tableau 4 en présence de 10 mM de complexe 10. Les cristaux de la protéine Protéase 1 ont été obtenus selon les conditions décrites dans le tableau 4 en présence de 10 mM de complexe 10 puis trempés dans une solution cryoprotectante contenant 100 mM de complexe 10.
    Dans les deux cas, compte tenu de la qualité de la détermination des phases, on obtient des cartes de densité électronique expérimentale aisément interprétables, où l'on distingue les chaînes latérales des acides aminés. Une tyrosine pour la carte de ia glyoxylate réductase et un tryptophane pour la carte de de ta protéine Protéase 1. Les images ont été produites à l'aide du logiciel coot. G) Application, de 1a. technologie à la détermination de la structure de la protéine MDH ANC80 a. Effet nucléant et cristallisant : le cas de la MDH ANC80
    La protéine MDH de PAWC8Q concentrée à 10 mg/mi a été envoyée au robot de cristallisation pour un criblage classique des 576 conditions. La condition de cristallisation la plus prometteuse est la condition ANC-1 du Tableau 7. Les photos obtenues au robot de cristallisation pour cette condition sont présentées Figure 12.
    Cette condition a été reproduite manuellement au laboratoire. Des cristaux sont apparus en présence de 10 mM de complexe 17 et 10 mM de complexe 10 en 7 jours. La même condition en condition native (sans complexe de lanthanide) a également été réalisée. Après environ 3 semaines, des cristaux de formes différentes sont apparus (non représentés).
    Les cristaux natifs ont été testés en diffraction. Celle-ci présente une résolution de l'ordre de 2,5 Â. Ces cristaux présentent une symétrie différente de celle obtenue pour les cristaux obtenus en présence de complexe 10 ou 17 (Groupe d'espace F2.22) avec des paramètres de maille de l'ordre de 81, 140 et 395 Â respectivement pour a, b, et c. Ceci est à comparer au groupe d'espace obtenu pour les cristaux en présence de complexe et à la résolution obtenue pour les données de diffraction. En effet, les cristaux en présence de 10 mM de complexe de lanthanide diffractent à 1,7 Angstrôm. Ainsi, les effets nucléants et cristallisants sont bien observés dans le cas de cette protéine.
    La détermination de la structure de la MDH de l'ANCSO a été réalisée selon la méthode MAD. Trois jeux de données ont été enregistrés sur le même cristal au seuil d'absorption Lra du terbium. Un jeu de données supplémentaire a été mesuré au seuil d'absorption K du sélénium pour obtenir la meilleure résolution possible. Les statistiques, après intégration sur ['ensemble des données collectées, sont présentées dans le Tableau 12 ci-après.
    Tableau 12 ..Collecte des données, phasage et statistiques d'affinements * selon la Figure 8,... L'affinement du.modèle conduit à des facteurs de qualité très.bons avec un facteur R. et Rfree de 19,2 et 21,2 %..
    Les complexes luminescents suivants ont été également testés à 10 mM et ne présentent pas d'effet sur la cristallisation :
    ANNEXE 1 : Séquence en acides aminés des différentes protéines testées
    Lysozyme (Gallus gallus) HEWL : SEQID N°1
    KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSR
    WWCNDGRTPGSRNLCNIPCSALLSSDÎTASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQ
    AWIRGCRL
    Thaumatine (T. danielli) : SEQ ID N°2
    ATFEIVNRCSYTVWAÂASKGDAALDAGGRQLNSGESWTTNVEPGTNGGKIWARTDCYFDDS
    GSGICKTGDCGGLLRCKRFGRPPTTLÂEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVR
    CAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKP
    TWTCPGSSNYRVTFCPTA
    Protéinase K (Tritirachium Album) : SEQ ID N°3
    AAQTNAPWGIARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSS
    RDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCP
    KGWASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRY
    DRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACR
    YIADTANKGDLSNIPFGTVNLLAYNNYQA
    Glyoxylate hydroxtypyruwate réductase (P. furiosus) : SEQ ID N°4
    MKPKVFITRAIPENGINMLEEEFEVEVWEEEREIPREKLLEKVKDVDALVTMLSERIDQEVFENA
    PRLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTNATADHAFALLLATARHWKGDKFVRS
    GEWKRKGIAWHPKWFLGYELYGKTIGIVGFGRIGQAIARRAKGFNMRILYYSRTRKSQAEKEL
    GAEYRPLEEVLKESDFVILAVPLTKETMYMINEERLKLMKPTAILVNIARGKWDTKALIKALKE
    GWIAGAGLDVFEEEPYYNEELFSLDNWLTPHIGSATFEAREAMAELVARNLIAFKRGEIPPTLV
    NKEVIKIRKPGFN EQ
    Protéase 1 (P. horikoshii OT3) ; SEQ ID N°5
    MKVLFLTANEFEDVELIYPYHRLKEEGHEVYÎASFERGTTTGKHGYSVKVDLTFDKVNPEEFDAL
    VLPGGRAPERVRLNEKAVSIARKNFSEGKPVASICHGPQILISAGVLRGRKGTSYPGIKDDMIN
    AGVEWVDAEVWDGNWVSSRVPADLYAWMREFVKLLK
    Pbi protéine majoritaire de la queue du phage T5 : SEQ ID N°6
    MSLQLLRNTRIFVSTVICrGHNKJNTQEILVQDDISWGQDSNSTDITVNEAGPRPTRGSKRFN DSLN AAEWSFSTYILPYKDKIMTSKQIVPDYMLWH ALSSGRAINLEGTTGAH N N ATN FM VN FK DNSYHELAMLHIYILTDKTWSYIDSCQINQAEVNVDIEDIG! 5GNGNQLIPLDEQPFDPD QIGIDDETYMTIQGSYIKNKLnLKIKDMDTNKSYDIPITGGTFTINNNnYLTPNVMSRVnPÏG
    SFTGAFELTGSLTAYLNDKSLGSMELYKDLIKTLKWNRFEIALVLGGEYDDERPAAILVAKQAH
    VNIPnETDDVLGTSVEFKAIPSDLDAGDEGYLGFSSKYTRTTIIMNLIVNGDGATDAVTAITVKS
    AGNVTTLNRSATLQMSVEVTPSSARNKEVTWArTAGDAATINATGLLRADASKTGAVTVEATA
    KDGSGVKGTKVITVTAGG ANC80 Malate Déhydrogénase (protéine synthétique) : SEQ 1D N°7
    MTKVSWGAAGTVGAAAGYNLALRDIADELVFVDIPDQEDVTIGQAADTNHGVAYDSNTTVR
    QGGYEDTAGSDVWrTAGIPRQPGQTRIDLAGDNAPIMEDIGSSLAEHNDDFVTITTSNPVDL
    LNRHLYETGDRAREKVIGFGGRLDSARFRWLSQRFDAPVQNVEATILGEHGDAQVPVFSKVR
    VDGTDPEFSADEKEEILGDLQESAMDVIERKGATQWGPATGVAHMVEAVLHDTGEVLPGSW
    LDGEFGHEDTAFGVPVKLGSNGVEEWEWDLDDYEQDLMDDAAEKLSDQYDKIA
    The present invention relates to the technical fields of crystallization and crystallography. More specifically, the invention relates to novel lanthanide complexes which can be used as phasing agents for the crystalline structure determination of biological macromotecutes, but also as an aid for their crystallization. The subject of the invention is also their use in these fields and the methods of crystallization and determination of structural data which implement them.
    The resounding success of your comprehensive determination of the human genome in 2000 paved the way for a broader area of research; structural genomics, which consists of determining the structure of proteins to understand the relationships between their structure and their functions. Due to the number and variety of existing proteins, this is a huge project whose scope in terms of scientific and medical benefits is unknown. Today, the two tools for this structural resolution are crystallography and nuclear magnetic resonance (NMR). These are two complementary techniques that offer advantages and limitations: (i) NMR allows for protein solution analysis, but requires isotopic enrichment; (i) crystallography allows faster determination of structures but remains dependent on the preparation of good quality crystals. Currently, the research effort is focused on the development of very large instruments to the detriment of the search for new methodologies.
    In this area, several successive difficulties must be overcome. The first difficulty lies in the field of biology and concerns the preparation and purification of proteins of interest and only 18% of the proteins donated cross this stage. The second difficulty concerns the crystallization step since again only 20% of the purified proteins can be crystallized and only half of these crystals will allow the determination of the structure by X-ray diffraction. In the balance sheet, only 1.8% of the cloned proteins are structurally characterized and this, at the cost of investments in terms of time and considerable human and financial resources.
    A crystal of a protein, or more generally of a biological macromolecule, consists of a regular and periodic stack of the molecules that compose it. The stack is maintained by contacts within the crystal (hydrogen bonds, salt bridges, hydrophobic contacts). Obtaining a crystal of a biological macromolecule is a key step in the determination of its structure by X-ray crystallography.
    It should be emphasized that crystallization processes of biological macromolecules are still far from understood and that current approaches are based on an empirical approach, of the trial / error type.
    One of the important concepts to consider in crystallogenesis is the concept of solubility. In solution, a macromolecule is surrounded by a solvation layer which has a repulsive and insulating effect and makes it possible to avoid self-aggregation and precipitation. Crystallization goes against this effect, since it is a question of moving away from the solubility conditions of the biological macromolecule by the addition of a precipitating agent, also called crystallizing agent. In the context of the present description, "precipitating agent And "crystallizing agent" are used interchangeably. Crystallizing / precipitating agent is understood to mean a molecule or a mixture of molecules that aids in the formation of a crystal of biological macromolecules under certain conditions.
    The general principle of crystallization is based on; Diagram presented in Figure I which corresponds to the diagram made by Mitjam Leunissen and appearing on http://people.ds.cam.ac.uk/ml527/publications/assets/ieunlsserhliterature- research.pdf.
    The two main steps that occur in the crystallization process are: nucleation and crystal growth. The crystallizing agent induces a change in the solubility and therefore the position on the diagram as a function of the. time. There are different crystallization methods using a crystallizing agent.
    The goal during a crystallization is to play on the concentrations of biological macromolecuie and crystallizing agent to achieve reaching the nucleation zone shown in the diagram of Figure 1. When this zone is reached, nuclei can form. (nucleation points). These nucleii are more or less organized aggregates of a hundred macromolecules. The formation of these "crystalline" departures decreases the concentration of soluble macromolecule. This is the beginning of crystalline growth. Other macromolecules come together on this nucieii and form micro-crystals that will grow with time,
    There are three major major classes of crystallizing agents: - salts, - organic solvents (ethanol, dioxane, MPD for methylpentanediol, etc.) - polymers (PEG (Poly-Ethylene Glycol) with molecular weights up to 20000 g / mol, JeffamineT etc ...)
    These agents have the effect of: competing with the biological macromolecule for water, or more generally the solvent in which the macromolecule is initially in solution, and thus reducing the solubility of the macromolecule, inducing its crystallization, to screen charges on the surface of the macromolecule allowing the approximation of several macromolecules, - to modify the dielectric constant of the solvent and consequently the forces between macromolecules - to favor phenomena of excluded volume type (hydrophobic exclusion).
    To obtain the crystallization of a protein, or more generally of a biological macromolecule, an automated approach allowing a screening of different commercially available crystallization conditions (kits from Hampton Research, for example). The crystallization experiments are prepared by robots and the crystallization phase is regularly monitored by microscope robots that scan the appearance of the crystals. This high-throughput approach has shifted the search for alternative methodologies to promote crystallization by finding agents that promote crystallization without denaturing the protein. Some work on this subject exists in the literature, such as the use of natural compounds: mineral solids (Falini G., Fermani S., Confort G., Ripamonti A. (2002), Acta Crystallogr D Biol Crystallogr, 58,: 1652, McPherson, A. & Shlichta, P. (1988), Science, 239, 385-387), substrate of biological origin such as hair, horsehair, rat whiskers or dried seaweed ( D'Arcy A., Mac Sweeney A. & Haber, A. (2003), Acta Crystallogr Biol Crystallogr 59, 1343-1346), but also synthetic products (Bijelic A., Molitor C., Mauracher S G. AI-Oweini, R, Kortz U. & Rompel, A. (2014), ChemBioChem, 16, 233-241, Pechkova, E. & Nicolini, C. (2002), J. Ceii. Biochem, 85, 243-251, Sugahara, M. Asada, Y. Morikawa, Y. Kageyama, Y. & Kunishima, N, (2008), Acta Crystallogr Biot Crystallogr 64, 686-695, Matar-Merheb, R. Rhimi, M. Leydier, A. Huché, F, Galian, C., Desuzinges-Mandon, E. Ficheux, D. Flot, D. Aghajari, N. Kahn, R. et al. (2011), PLoS ONE. 6, el8036).
    In all these cases, crystalline growth occurs in contact with these "impurities". The most accomplished work in this field is that of the team of Naomi E. Chayen who proposes the use of mesoporous materials, capable of inducing nucleation in the pores after a step of concentration / aggregation within these same pores. (WO 02/088435). The same group also describes the use of MIP "molecular imprinted polymers" based on the same principle. These are polymers previously printed by the protein to be crystallized and which therefore contain the trace. Then added to the drop of crystallization, a shape interaction can occur favoring nucleation (Saridakis, PNAS, 2001, 108, 11081). All these crystallization aid agents are solids forming a heterogeneous phase in the crystallization medium, each of which must therefore be added manually to the crystallization drop, which is irreconcilable with the use of robotic screening platforms, except for MIPs.
    Moreover, because of the enormous size of biological macromolecules, such as proteins, the determination of their structure by X-ray diffraction involves solving the problem of crystallographic phases. This implies to possess a native crystal (pure protein) and / or a derived crystal containing a heavy atom easily identifiable and to remove the problem of .phases, it is called phasing agent. The most conventional method, based on anomorphous diffraction at several wavelengths (MAD), is based on the substitution of the sulfur of the methionine amino acids of the protein by a selenium atom. Used since the 1990s, this method has revolutionized macromolecular crystallography, but it involves the synthesis, purification, crystallization and resolution of the structure of analogous protein-like proteins. It is a very expensive method in time. Other exogenous phasing agents can be used and are also marketed. Bromine, heavy metals (Pt, Au, Hg) can be mentioned. In this context, R. Kahn showed in the early 2000s that lanthanides, which exhibit some of the most intense anomalous effects, can be included as complexes in protein crystals, which allows the structure of the macromolecule if the lanthanide is fixed (E. Girard, M.
    Stelter, PL Aneili, J. Vicat, Kahn R., Acta, Cristailogr, D, 2003, D59, 118; E. Girard, PL Anelli, J. Vicat, R. Kahn, Acta. Cristailogr. D, 2003, D59, 1877). To date, five lanthanide complexes are marketed as a phasing agent by the company NatX-ray.
    In = 'Eu, Yb, (and Gd for HPD03A)
    There are some luminescent phasing agents in the literature, such as functional derivatives of DPA3 (FR 2 991 322 and ACIE 2008) or lanthanide complexes directly grafted to the protein structure (XC Su, HB Liang, KV Loscha and G. Otting 3. Am., Chem Soc., 2009, 131, 10352-10353).
    Among all these derivatives, tri-anionic complexes [(DPA) 3Ln] 3 ~ seemed very promising because specific interactions with cationic amino acids and in particular with arginine have been demonstrated by some of the inventors of the present invention. patent application (E. Dumont, G. Pompidor, A. D'Aléo, J. Vicat, L. Toupet, R. Kahn, E. Girard, O. Maury, N. Giraud, PhysChemChemPhys 2013, 15, 18235-18242 ), and confirmed by NMR measurements (XC Su, HB Liang, K, Loscha, V., G. Otting, J. Am., Chem Soc., 2009, 131, 10352-10353). Unfortunately, this compound has been shown to be unstable in a large number of commercial crystallization kit formulations: (1) the presence of transition metals (Zn (II), Cu (II), Fe (II)) induces destructuring of the complex, (II) the presence of divalent alkaline earth salts (Ba (II), Ca (II), Mg (II)) causes the immediate self-crystallization of the complex giving rise to detection of false-positives ( crystals of complexes and not crystals derived from proteins) (PhD thesis of R. Talon supported in Grenoble on June 6, 2012). Other solutions have proposed introducing lanthanides into the protein crystals to obtain a phasing effect Nagem et al. (Nagem, RA, Dauter, Z. & Polikarpov I, Acta Crystallogr D, 2001, D57, 996-1002) have proposed using lanthanide salts and the rapid dipping method (Dauter Z., Dauter, M. & Rajashankar, KR Acta Crystallogr D, 2000, D56, 232-237). This method developed initially for the halide salts (NaCl, NaI, NaBr) consists in soaking, for a time less than one minute, the crystals in a very concentrated saline solution (> 1 mol L1). In the case of lanthanide salt, this method led to rapid degradation of the crystals. Purdy et al. (Purdy MD, Ge P, Chen J., Selvin PR, & Wiener, MC Acta Crystallogr D, 2002, D58, 1111-1117) have proposed to use a covalent bond linking lanthanide complexes (where the ligand ensures complete coordination of the lanthanide) with the protein. The bond consists of a disulfide bridge formed between free cysteines of the protein and a thiol reactive function carried by the complex. Finally, Silvaggi et al. (Silvaggi, N.R., Martin, LJ, Schwalbe, H., Imperial), B., Allen, KNJ, Am. Chem. Soc., 2007 129, 7114-7120) have proposed the use of a "tag" fixing one or two lanthanides (LBT for Lanthanide-Binding Tag). LBT is based on a calcium-derived peptide sequence that can be introduced into proteins by conventional molecular biology techniques (Allen, KN Imperiali B., Current Opinion in Chemical Biology, 2010, 14, 247-254). .
    There is therefore a need for new phasing agents that do not require modifying the structure of biological macromolecules, whose structure is desired to be determined. Additionally, the invention proposes to provide phasing agents which are sufficiently stable under most conditions of crystallization of biological macromolecules and which also make it possible to widen the possibilities of obtaining crystals making it possible to obtain structural information on the biological macromolecule of interest
    In this context, the invention relates to cationic complexes formed of an lanthanide ion ln3 + and a ligand of formula (I):
    in which. X and Y, which are identical or different, each independently represent -CHr (CH2) n-, -CH2-CCH2) n "A-CH2CH2" or -CH2-CR3RVCH2-, X being read on the general formula (I ) from the left to the right and Y reading on the general formula (I) from right to left, with: ο n which is equal to 1, 2 or 3; o To which represents -NR2-, -0 ( CH 2) 20- or -O-, with R 2 being a hydrogen atom or a methyl group or -CH 2 R 5, where R 5 represents a phenyl, pyridinyl or picolinyl group, R 3 represents a methyl group, and R 4 which represents -NHR * with R4 which represents -H, -CH3, -CH2R6, where Re represents a phenyl or pyridinyl group;
    with: R7 which represents -COO, -COIMH2, -CONHR9, -PR900, or a group chosen from:
    with R 9 which represents a hydrogen atom, a methyl, ethyl or phenyl group; and α * 8 which represents a hydrogen, fluorine, chlorine, bromine or iodine atom, an -OH or -NH 2 group; it being understood that at least one of X and Y is different from -CH 2 -CH 2 V-, and their salts with an anion, their solvates and hydrates; with the exception of the cationic complexes formed of a lanthanide ion Ln3 + and a ligand corresponding to one of the following formulas (U) to (1.5), and their salts with an anion, their solvates and hydrates:
    The ligands of formula (I) comprise at least 7 coordination sites for a lanthanide ion Ln3 +, or even more, depending on the structures of X and Y. These coordination sites are located on the two nitrogen atoms represented on the formula ( I), on the two pyridines of the groups R 1, on the two groups R 7, at least one coordination site lying on X and / or Y.
    The complexes according to the invention, as well as the lanthanide complexes formed with the ligands of formulas (1.1) to (1.5), are cationic and have a positive charge greater than or equal to 1. They comprise a macrocidal ligand incorporating several aromatic groups forming an open coordination sphere for the lanthanide ion. These aromatic groups, when the ln3 + ion is Eu3 + or Ib3 +, also act as antennas to sensitize luminescence of the lanthanide in the visible.
    Moreover, the complexes according to the invention have the advantage of being soluble in water and stable in most commercial crystallization media. In the context of the invention, it has been demonstrated that these complexes were of interest, not only as phasing agent, in obtaining structural data, but also as aids in crystallization. In particular, said complex is used as a nucleating agent and / or as a crystallizing agent during the crystallization of a biological macromolecule. Such applications have never been described or envisaged for the lanthanide complexes formed with the ligands of formulas (1.1) to (1.5) already described in the literature (Mato-Iglesias et al., Inorg Chem. 47, 7840-7851, Z. Palinkas et al., Inorg Chem 2009, 48, 8878-8889, A. Roca-Sabio et al., Dalton Trans, 2011, 40, 384-392 and M. Regueiro-Figueroa. et al., Inorg Chem., 2015, 54, 4940-4952 for complexes of ligands (1.1) to (1.3) and A. Rodrigues-Rodrigues et al., Inorg Chem., 2012, 51, 2509-2521, for ligand complexes (1.4) and (1.5)). Indeed, these complexes were prepared for fundamental studies of coordination chemistry of lanthanides (study of the stability of complexes formed with different lanthanides) and in the case of Gd, only applications as an MRI contrast agent were considered.
    Advantageously, the complexes according to the invention, as well as their salts with an anion, their solvates and hydrates, are formed with a ligand corresponding to one of the following formulas:
    with R 1, R 2, n and R 4 which are as defined for formula (I). By way of example of salts, complexes according to the invention or complexes formed with one of the ligands (1.1) to (1.5) which find application in the context of the invention, mention may be made of the salts of a cationic complex with one anion (or several anions, depending on the charge of the complex) chosen from: CI ', Br ", Γ, OH', N03", triflate, PFe ', SbFs', B (Ph) 4', BF4 ~, sulfates, sulfonates, carbonates, phosphates, phosphonates and carboxylates. The sulphates and sulphonates may correspond to S042 ', HSO3' or R'SO3 ', the carbonates to CO32 ", HCO2" or R'CO2. ", The phosphates and phosphonates to ROP03Z" and R'PO32 "and the carbonates to R "CCL", with R 'which may be, in particular, an alkyl or aryl group, especially an alkyl group comprising from 1 to 4 carbon atoms or a phenyl group. Under 1a. salt form, the complexes according to the invention may also be in the form of hydrate or solvates, that is to say with at least one molecule of water.or solvent in the coordination sphere of the lantbanide.
    Preferably, the complexes according to the invention, as well as their salts with an anion, their solvates and hydrates, are formed with a ligand corresponding to formula (IA);
    wherein η-1 and R 2 = H, and R 1 is as defined for compounds of formula (I).
    Advantageously, in the ligands of formula (I), (IA) to (IF), R 1 represents:
    with: - R7 which represents -COO 'or -PRgOO' with R9 which represents a methyl or ethyl group; or R which represents a group:
    - Rs which represents a hydrogen atom, fluorine, chlorine, bromine or iodine.
    In the context of the invention, when a substituent represents a polyalkyl group, it represents:
    In a preferred manner, the complexes according to the invention are chosen from the complexes of formula:
    as well as their salts with an anion, in particular their hydrochloride salt, their solvates and hydrates.
    Advantageously, the complexes according to the invention or the complexes formed with one of the ligands (1.1) to (1.5) which find application in the context of the invention, as well as their salts with an anion, in particular their salt. Hydrochloride, their solvates and hydrates, are formed with a lanthanide ion Ln3 +, Ln being Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb or Lu, with Eu, Tb, Yb and Lu which are preferred. another subject of the invention is the use of a complex according to the invention, or of a cationic complex formed of a lanthanide ion Ln3 + and of a ligand of formulas (1.1) to (1.5) as defined above, or a salt thereof with an anion, solvates or hydrates thereof, as an aid for the crystallization of a biological macromolecule, In particular, said complex is used as a nucleating agent and / or as a crystallizing agent during the crystallization of a biological macromolecule.
    All the lanthanide complexes according to the invention, or formed with a ligand of formula (II) to (1.5), are of interest for their nucleating or crystallizing effect. However, only terbium or europium complexes will have visible luminescence properties. Also, if in the complex, Ln = Eu or Tb, the complex can also be used as a luminescent agent for the detection of crystals. The subject of the invention is also the use of a complex according to the invention, or of a cationic complex formed of a lanthanide ion Ln3 + and of a ligand of formula (1.1) to (1.5) as defined above. , or of one of their salts with an anion, their solvates or hydrates, as an aid in obtaining structural data of a biological macromolecule. In particular, said complex is used as a phasing agent during the structural determination by X-ray diffraction. Here again, if in the complex, Ln = Eu or Tb, the complex can also be used as a positioning of the crystal in an X-ray beam.
    In particular, in the context of the invention, the term "biological macromolecule" refers in particular to peptides (sequence of less than 100 amino acids), proteins (sequence of at least 100 amino acids) and acids. Nucleic acids, in particular DNA or RNA, Such biological macromolecules will in particular have an average molecular mass greater than 1 kDa The invention also relates to crystals derived from a biological macromolecule comprising a complex according to the invention or a complex cationic composition formed of a lanthanide ion Lm3 + and a ligand of formula (1.1) to (1.5) as defined above, or a salt thereof with an anion, silicate or hydrate.The invention also relates to a method of crystallization of a biological macromolecule, preferably selected from peptides, proteins and nucleic acids, in particular DNA or RNA, comprising the following steps: - having a solution comprising comprising said biological macromolecule and a complex according to the invention, or a cationic complex formed of a lanthanide ion Ln3 + and a ligand of formula (1.1) to (1.5) as defined above, or a salt thereof with an anion , solvate or hydrate, - obtain crystals of the macro molecule from said solution.
    The solution used may also comprise a precipitating agent, other than the complex, chosen in particular from those used in commercial crystallization kits, in particular from those present in the tables presented in Annexes 2A or 2B, for example, salts such as ammonium salts, sulphates (in particular ammonium sulphate), acetates, phosphates, citrates (especially sodium citrate), formates, tartrates such as sodium or potassium tartrate, double tartrate, sodium and potassium, chlorides, iodides and fluorides, for example NaCl; polymers such as polyethylene glycols and Jeffamine T; ethanol, dioxane, methylpentanediol, glycerol, isopropanol, 2-methyl-2,4-pentanediol.
    Advantageously, in the solution, the complex is present at a concentration of 1 to 100 mM, preferably at a concentration of 1 to 25 mM, and even more preferably at a concentration of 10 mM ± 10%.
    In particular, obtaining crystals is carried out by crystallization by vapor diffusion, by dialysis, in batch or in a method of crystallization in cubic phase of lipids.
    The crystallization process according to the invention may be integrated in a screening or optimization of crystallization conditions of a biological macromolecule. The crystallization process according to the invention can be implemented in an automated manner. The invention also relates to a method of analysis or determination of 1a. structure of a biological macromolecule comprising the following steps: a) having a crystal derived from the biological macromolecule as defined in the context of the invention, b) analyzing the crystalline structure of the biological macromolecule from said derived crystal.
    The derivatized crystal may be obtained according to a crystallization process as described in the scope of the invention or by soaking a crystal of the biological macromolecule in a solution of a complex according to the invention or of a cationic complex formed of a lanthanide ion Ln3 + and a ligand of formula (1.1) to (1.5) as defined above, or of one of their salts with an anion, their solvates or hydrates. The derived crystal may also be obtained by dipping a crystal derived from the biological macromolecuie obtained according to a crystallization process as described in the context of the invention, in a solution of a complex according to the invention or a cationic complex formed of a lanthanide ion Ln3 + and a ligand of formula (1.1) to (1.5) as defined above, or of one of theirs's'with an anion, their solvates or hydrates.
    In particular, the analysis of the crystalline structure of the biological macromolecule from said derived crystal corresponds to the determination of the structure of the biological macromolecule and is performed by X-ray diffraction (RX). It is also possible that it corresponds to the obtaining of structural data by a high resolution method, such as X-ray diffraction (RX) or by a low-resolution method by SAXS methods (Small-Angle X-ray Scattering ) or MASC (Multilavelength-Anomalous Solvent Contrast).
    The following detailed description provides a better understanding of the invention.
    The cationic complexes formed of an Ln3 + lanthanide ion and a ligand of formula (I) corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF) are cationic complexes, and in particular mono-cationic. They are: therefore capable of leading to the formation of crystals derived from a biological macromolecule. Such derived crystals may be obtained by dipping or co-crystallization, as detailed below. The anomalous effect due to the presence of lanthanides in the derived crystals obtained, leads to a phasing effect and facilitates the determination of the structure of the biological macromolecule concerned, in particular by X-ray diffraction. The complexes according to the invention can therefore be used as an aid in the determination or analysis of the crystalline structure of a biological macromolecule.
    The cationic complexes formed of a lanthanide ion Ln3 + and a ligand of formula (I), corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF), as well as their salts, solvates and hydrates can also be used as aids for the crystallization of biological macromolecules. Indeed, depending on their structure, and depending on the crystallization conditions used, the complexes according to the invention have at least one of the following properties: - nucleating effect: the presence of said lanthanide complex during crystallization causes crystal growth under conditions (buffer and / or additives and / or temperature and / or concentration and / or duration ...) that do not allow the formation of crystals in the absence of the complex according to the invention. crystallizing effect: the presence of said lanthanide complex during tests of a series of crystallization conditions (number of crystals and / or size of the crystals and / or improvement of the diffraction of the crystals obtained), makes it possible to improve the crystallization obtained, compared to a series of conditions differing in the absence of complex. In the absence of complex, crystals appear but are of less good quality.
    In particular, the lanthanide complexes formed with the ligands of formula (I) formed of a lanthanide ion Ln3 + and a ligand of formula (I), corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF), as well as their salts, solvates and hydrates, either make it possible to increase the number of conditions under which the obtaining of crystals of a biological macromolecule is possible, or to work under weaker conditions. biological macromolecule and / or other precipitating agent conventionally used, either to improve the quality or the number of crystals' thus favoring the obtaining of subsequent structural data, or to obtain several of these advantages.
    The Europium and Terbium complexes also have the advantage of being luminescent under UV irradiation. Thus, their use makes it easy to bring out the crystals derived during the crystallization tests. This property can be used as a rapid detection method for crystallization platforms equipped with automatic imager under UV irradiation. In addition, this property can be used as a centering aid in an X-ray beam during a diffraction characterization in particular.
    The complexes according to the invention may be prepared according to techniques adapted by those skilled in the art, techniques described in the examples or in the application WO 2014/182105. The synthesis of the complexes according to the invention is generally carried out in water. The complexes thus formed will therefore rather be in the form of hydrate, but the complex may then be put in a different solvent, alcohol or DMSQ type and give rise to a solvate or be dehydrated. In hydrated form, a complex according to the invention will comprise, in particular up to 3 molecules of water per complex. On average, the number of water molecules per complex, may, on the other hand, be different from an integer, and be for example equal to 0.5. For the applications envisaged in the context of the invention, the lanthanide complexes according to the invention may be used in hydrated form, or dehydrated, solvated or non-formally, in powder form or in solution.
    The quality and the purity of a crystallizing agent are essential for the good progress of the crystallization of a macromolecule, when these are used as crystallization agent. Also, in the end, the lanthanide complexes according to the invention will be subjected to a suitable purification step, in particular by steric exclusion chromatography.
    The cationic complexes formed of a lanthanide ion Ln3 + and a ligand of formula (I), corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF), as well as their salts, solvates and hydrates, can be used as crystallizing agent in any technique suitable for the crystallization of biological macromolecules.
    For a detailed description of such techniques, reference may be made to the following references: "Protein Crystallization, Second Edition (IUL Biotechnology Series)" edited by Therese Bergfors or "Crystallization of Nucleic Acids and Proteins: A Practical Approach" edited by Arnaud Ducruix and Richard Giegé.
    In particular, the cationic complexes formed of a lanthanide ion Ln3 + and a ligand of formula (I), corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF), and that their salts, solvates and; hydrates can be used as crystallizing agent in a process of crystallization of biological macromolecules by vapor diffusion, by dialysis, in batch or in a method of crystallization in cubic phase of lipids.
    These different techniques will each be described briefly, the crystallizing agent meaning a lanthanide complex or mixture of crystallizing agents containing at least one lanthanide complex with a ligand of formula (I), in the form of salts, solvates or hydrates: - Vapor diffusion crystallization is the most widely used. This is the method generally implemented at the level of automated crystallization platforms. There are three different approaches schematized in Figure 2: Sitting drop techniques, Hanging drop and Sandwich drop. These three techniques are shown schematically in Figure 2.
    In these three approaches, a solution of the crystallizing agent is placed in a well (solution in light gray). The solution containing the biological macromolecule of interest is mixed with the crystallizing agent and deposited in the form of a drop (either suspended, sitting or sandwich). The crystallization well is sealed by a glass slide or a plastic film. At the start of crystallization, the concentration of crystallizing agent in the drop is twice as low as in the well. The system being closed, it sets up a diffusion kinetics of the solvent of the drop (usually water) to the well. The volume of the drop will therefore decrease (loss of solvent ie water) and concentrations of biological macromolecule and crystallizing agent will thus increase allowing, in favorable cases, to reach the nucleation phase. In this method, the concentration of crystallizing agent is extremely important. Indeed, an excess of crystallizing agent could cause a diffusion kinetics of the solvent too fast and thus cause the precipitation of the biological macromolecule. Conversely, too low a concentration will not reach the nucleation zone. The appropriate concentration of crystallizing agent will therefore be determined, by routine tests, by those skilled in the art. From nucleation, crystalline growth will then decrease the soluble macromolecule concentration to a steady state. - Dialysis is another method of crystallization that remains less used than vapor diffusion. This technique is shown schematically in Figure 3.
    The general principle is to slowly grow the concentration of crystallizing agent. For this, a solution containing the biological macromolecule of interest is placed in a dialysis container, for example of the capillary type or dialysis button closed by a semi-permeable membrane passing through the crystallizing agent molecules (but not the macromolecule) . This container is then placed in a solution of crystallizing agent. An equilibrium between the solution containing the biological macromolecule of interest (which does not contain crystallizing agent) and the external solution containing the crystallizing agent will be put in place. Thus, the concentration of crystallizing agent in the dialysis container will increase and modify the solubility of the macromolecule. This technique has the advantage of being more accurate than vapor diffusion in maintaining pH and volumes. However, the manipulation of the crystals remains much more delicate. - The crystallization in batdresbla last technique used to crystallize biological macromolecules. "This technique, just like dialysis, requires a large volume of solution."
    The principle of this technique, shown schematically in Figure 4, is simple: the highly concentrated macromolecule is mixed with the crystallizing agent. The supersaturated solution of macromolecule will, over time, induce the formation of nucleii which will induce the decrease of the concentration of the macromolecuie in solution, towards the formation of crystals.
    The techniques of crystallization by vapor diffusion, crystallization by dialysis or batch crystallization work on all types of proteins whether they are soluble in water or that they are membrane, then soluble in detergent, as well as on other biological macromolecules (DNA, RNA, protein complexes, protein-DNA or RNA complexes ...).
    For crystallization of membrane proteins, it is also possible to use a lanthanide complex as a crystallizing agent in a cubic phase crystallization technique of lipids. The cubic phase crystallization of lipids of membrane proteins is described in the following publications: Landau et al. Lipidic cubic phase: A novel concept for the crystallization of membrane proteins, PNAS Vol. 93 no. 14532- 14535 (1996), Caffrey et al, Crystallizing membrane proteins using lipidic mesophases. Nat. Protoc 4 (5) 706-31 (2009), Cherezov V., Lipidic cubic phase technologies for membrane protein structural studies. Curr. Opin Str vi: ·! Vol 21, 559-566 (2011).
    Lanthanide complexes formed of a lanthanide ion Ln3 + and a ligand of formula (I), corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF), as well as their salts , soivats and hydrates are compatible with all the crystallization methods which have just been detailed.
    In particular, a solution containing a concentration of 1 to 100 mM, preferably .1. 25 mM of a lanthanide complex formed of a lanthanide ion Ln3 + .and a ligand of formula (I), corresponding to the complexes according to the invention or complexes formed with a ligand of formula (IA) to (IF), in the form of a se !. with an anion, optionally in the form of a solvate or a hydrate, and even more preferably 10 mM ± 10% will be used.
    In the crystallizations, in particular in the vapor phase or in batch, a solution of the biological macromolecule to be crystallized and of a lanthanide complex formed of a lanthanide ion Ln3 + and a ligand of formula (I), corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF), in the form of a salt with an anion, optionally in the form of a solvate or a hydrate (which will, for the sake of for simplification, in the rest of the description, called lanthanide complex), will be prepared, preferably with a concentration of 1 to 100 mM, preferably 1 to 25 mM, and even more preferably 10 mM ± 10%, lanthanide complex. The lanthanide complex formed by a lanthanide ion Ln3 + and a ligand of formula (I), corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF), in the form of a salt with an anion, optionally in the form of a solvate or a hydrate, can be directly solubilized by the solution containing the biological macromolecuie to reach a final complex concentration of 1 to 100 mM, preferably from 1 to 25 mM, and preferably 10 mM ± 10% which corresponds to the concentration at which the nucleating effect is preponderant. The lanthanide complex can also be introduced from a solution at a preferential concentration of 10 to 30 mM, during the manufacture of a drop of crystallization: a volume of the solution of macromolecules, an identical volume, is then added successively. of the lanthanide complex solution and an identical volume of well solution · used for crystallization.
    In these crystallization techniques, the lanthanide complex and the biological macromolecule to be crystallized will be dissolved generally in water or in an aqueous buffered solution (see examples in the description of the crystallization kits in Annexes 2A and 2B). for example, in an acetate buffer solution, cacodylate, citrate, bis tris propane, TRIS, HEPES, phosphate. Solutions containing a biological macromolecule are generally buffered. If a solution of the lanthanide complex is formed, it will not necessarily be buffered. The solution containing the complex, the solution containing the biological macromolecule and / or the solution containing the biological macromolecule and the complex, depending on the crystallization technique used, will preferably have a pH in the range of 3 to 9.
    Additives such as already known additives-to act as a precipitating / anti-drying agent or additives for promoting the dissolution of the biological macromolecule to be crystallized can be added. By way of examples, mention may be made of those present in the tables presented in Appendix 2A or 2B, such as, for example, salts such as ammonium salts, sulphates (in particular ammonium sulphate), acetates, phosphates citrates (especially sodium citrate), formates, tartrates such as sodium or potassium tartrate, sodium and potassium double tartrate, chlorides, iodides and fluorides, for example WaO; polymers such as polyethylene glycols and Jeffamine T; ethanol, dioxane, methylpentanediol, glycerol, isopropanol, 2-methyl-2,4-pentanediol. In particular, it is possible to use the lanthanide complex in any crystallization solution already marketed.
    The concentration of macromolecule in the solution will in theory be close to its solubility limit in said solution, but may be more diluted, depending on the solution used.
    The lanthanide complexes formed of a lanthanide ion Ln3 + and a ligand of formula (I), corresponding to the complexes according to the invention or to the complexes formed with a ligand of formula (IA) to (IF), in the form of a salt with an anion, optionally in the form of a solvate or a hydrate, may also be used to obtain crystals derived from biological macromolecules, that is to say crystals containing said lanthanide complex. In particular, said lanthanide complex will be attached to a specific position of the biological macromolecule to be studied for determining the structure of said biological macromolecule studied.
    The determination of the phases can be made with derived crystals obtained in a solution containing from 1 to 100 mM complex, preferably from 10 to 100 mM, and even more preferably from 100 mM ± 10% to said lanthanide complex. However, to improve the quality of the phasing, soaking in a solution of a lanthanide complex, particularly with a high concentration of complex, can also be achieved. This increases the occupancy rate of complex-occupied sites.
    The co-crystallization thus consists in adding the lanthanide complex during the crystallization process. Thus, during crystallization, the lanthanide complex can be inserted into specific crystalline sites leading to the production of derived crystals.
    On the other hand, to obtain a derived crystal or to increase the lanthanide complex occupancy of sites in the derived crystal, a soaking of a crystal of a biological macromolecule in a lanthanide complex solution can be performed. I! it is possible to carry out a fast soaking or a long soaking.
    Rapid soaking consists in taking a crystal of a biological macromolecule of interest and in soaking it briefly (in particular from 45 seconds to 2 minutes) in a solution of the lanthanide complex. Advantageously, the solution in which the crystal is quenched has a high concentration of lanthanide complex, typically a concentration of 50 to 500 mM, preferably 100 mM ± 10%.
    In particular, rapid soaking during a freezing phase of one or more crystals can be achieved. Rapid soaking during a freezing phase typically takes place in three stages; crystals are taken from their original drop and soaked in a soaking dip, corresponding to a solution equivalent to the original solution used for the formation of the crystal (s) to which is added a concentration of 50 to 500 mM, preferably 100 mM. ± 10% lanthanide complex, as well as a cryoprotectant as used by those skilled in the art. After 45 seconds to 2 minutes, the crystal is soaked in cryoprotectant solution without lanthanide complex to remove excess. Finally, the crystal is immersed in liquid nitrogen and stored at low temperature, for example at 1QQK.
    This method of dipping is very effective and can increase the occupancy rates and improve the quality of phasing. By way of example, in the case of the PhP1 protein, a 45 second soak in a 100 mM solution of complex 10: has increased the occupation rate of the complex by 3. Short dipping avoids that. crystal does not degrade and preserve the diffraction qualities of the latter.
    Long soaking consists in taking a crystal of a biological macromolecule of interest and in soaking it for a prolonged period (in particular from 10 minutes to 24 hours) in a solution of the lanthanide complex. Advantageously, the solution in which the crystal is quenched has a high concentration of lanthanide complex, typically - a concentration of 50 to 500 mM, preferably 100 mM ± 10%. With the exception of the duration:, the long soaking can proceed according to the same protocol as that described for fast soaking, especially during a freezing phase. However, the soaking drop is placed in equilibrium with a well containing the original solution used for the formation of said crystal (s), in order to avoid dehydration of the drop.
    Whatever the type of dipping, it is possible to temper both crystals obtained by co-crystallization, in the presence of a lanthanide complex, and crystals obtained in the absence of such a complex (called crystals native in the context of this patent application). Soaking does not cause any destruction or modification of the biological macromolecule.
    The tanthanide complexes make it possible to form crystals derived from a biological macromolecule for obtaining structural data for said biological macromolecule. In particular, the obtaining of structural data will be obtained from a crystal derived from a biological macromolecuie incorporating a lanthanide complex which acts as a phasing agent. These structural data can be obtained by a high resolution method, such as X-ray diffraction (XR) or by a low resolution method, such as the SAXS and MASC methods. The lanthanide complexes can be used as phasing agent in X-ray diffraction (crystallization and structure analysis) or in X-ray diffusion, or as contrast agent in SAXS or MASC, by electron microscopy. The use of lanthanide complexes formed of a lanthanide ion Ln3 + and a ligand-of formula (I), corresponding to the complexes according to the invention or to the. complexes formed with a ligand of formula (IA) to (IF), in the form of a salt with an anion, optionally in the form of a solvate or a hydrate, as phasing agent in particular, has the advantage of not requiring modification of the biological macromolecule by genetic engineering, as in the case of obtaining selenium proteins. No covalent bond occurs between the lanthanide complex and the biological macromolecule of interest
    The examples below, with reference to the appended figures, illustrate the invention but have no limiting character.
    Figure 1 represents a phase diagram, illustrating the crystallization process (Excerpt from http://people.ds.cam.ac.uk/ml527/publications/assets/leunissen-literature-research.pdf)
    The Figure, -2 represents three different approaches: the techniques of the "Sitting drop", the hanging drop ("Hangîng drop" in English) and the "sandwich drop". ).
    Figure 3 shows the dialysis technique: another method of crystallization that remains less used than vapor diffusion.
    Figure 4 schematically shows a batch crystallization technique used to crystallize biological macromolecules.
    FIG. 5 shows phase diagrams of the lysozyme protein in the absence (on the right) and in the presence of complex 10 or 17 determined at different crystallization times: the conditions, having given crystals, are illustrated by black dots, the dots whites being clear drops.
    Figure 6 shows phase diagrams of chicken egg white lysozyme in the absence and in the presence of 10 mM of complex 11 determined after 4 days of crystallization. Conditions giving crystals are illustrated by black dots, white dots are clear drops and triangles of precipitates.
    Figure 7 shows phase diagrams of the PB6 protein in the absence and in the presence of 10 mM of complex determined after one day of crystallization. Conditions giving crystals are illustrated by black dots, white dots are clear drops and triangles of precipitates.
    Figure 8 shows crystals of pb6 (condition pb6-1) in the presence of 10 mM right complex (13% PEG-10 mg / ml) and no complex on the left (15% PEG-20 mg / ml) .
    Figure 9 shows the demonstration of the luminescence induced in the crystals by the nanhanide complexes.
    Figure 10 shows an X-ray fluorescence spectrum measured on a 10 mM solution of complex (left) and treatment with CHOOCH software (right). The wavelengths for the recordings making it possible to exploit optimally the anomalous diffusion of the lanthanide (in this case terbium) are indicated by an arrow.
    Figure 11 shows examples of experimental electronic density maps.
    Figure 12 represents images obtained with the HTXIab crystallization robot.
    Examples of realization
    Part I: Synthesis and Characterization of Complexes The following abbreviations are used:
    Me = methyl
    Moz = methoxybenzyloxycarbonyl
    Boc = tert-butoxycarbonyl Ms = mesyy
    Et = ethyl TA = ambient temperature Ac = acetyl DCM = dichioromethane TACN = triazacyclononane DM F = dimethylformamide TFA. = trifluoroacetic acid .... ACN = acetonitrile TLC = thin layer chromatography Starting materials and characterization
    All starting materials, solvents and lanthanide salts were purchased from Sigma-Aldrich®, Acros Organics® and TCI® with purities greater than 98% for organic compounds and greater than 99.99% for lanthanide salts. These products were used directly without further purification.
    The chromatographies were carried out, on the one hand, on neutral alumina activity III obtained by hydration of Acros Organics® alumina of activity I (60 °), and on the other hand, on silica gel Acros Organics® (60 °). The complexes formed were all purified by Sephadex® LH20 size exclusion column.
    The NMR spectra (XH, 13C) were recorded on two Bruker® Avance devices operating respectively at 500.10 MHz and 125.75 MHz for dH and 13C for one, and at 300 MHz for * H for the second. The chemical shifts are reported in part per million (ppm) relative to the tetrarriethylsiiane signal (* H, 13C), with the residual peaks of the solvents being used as internal reference.
    The exact mass measurements were made at the Joint Center for Mass Spectrometry (Villeurbanne, France). A) Preparation of a first series of ligands / complexes based on triazacyciononane (TACN)
    a) HCl (cat) in MeOH b) NaBH4 in DCM / MeOH c) MsCI, Et3N in DCM d) Moz-on, Et3N in ACN e) Boc-O-sucdinimide in DCM f) H2, Pd / C in MeOH g ) Na2CO3 in MeOH / H2O h) TFA in DCM 1) Na2CO3 in ACN j) Na2CO3 in H2O then LnCh, 6 (H2O) with Ln = Tb or Eu
    Compound 6 was prepared according to the procedure previously described in patent application WO2013 / 011236A1,
    Al) Preparation, of compound 1
    To a suspension of 20 g of dipicylic acid (0.12 mol, 1 eq) in 120 ml of methanol, 1 ml of concentrated sulfuric acid is added and the mixture is refluxed for 24 hours. After cooling, the crystallized product is filtered and rinsed with cold methanol to give, after drying, 18 g of white crystalline powder of compound 1 (R = 78%). * H-NMR (300 MHz, CDCl 3) δ (ppm) = 8.26 (d, J = 8 Hz, 2H), 7.99 (t, J = 8 Hz, 1H), 3.98 (s, 6H). A23 Preparation of compound 2
    18 g of compound 1 (92 mmol, 1 eq.) Are dissolved in 450 ml of methanol and cooled to 0 ° C. 3.8 g of NaBH4 (101.2 mmol, 1.1 eq) are then added. The mixture is then stirred for 30 min at 0 ° C. and an additional 30 min while the temperature is slowly raised to RT. The reaction is stopped by adding 50 ml of HCl (1M in H 2 O) and then the organic phase is extracted with 100 ml of dichloromethane. After washing the organic phase with brine (to pH = 7), drying with Wa25G4 and evaporation, the product obtained is purified by chromatography on silica gel (eluent: DCM / AcOEt 9/1 v / v up to pure AcOEt). 6 g of a white solid of compound 2 (R.sub.r = 40%) are obtained. NMR (300 MHz, CDCl 3) δ (ppm) = 8.01 (d, J = 8 Hz, 1H), 7.84 (t, J = 8 Hz, 1H), 7.53 (d, 3 = 8 Hz, 1H), 4.85 (d, J = 3 Hz, 2H), 3.98 (s, 3H), 3.69 (bs, 1H). A3) Preparation of compound 3
    To a solution of 1.2 g of alcohol 2 in 50 ml of dichloromethane at 0 ° C., 3 ml of Et3N (22 mmol, 3.2 eq.) Are added, followed rapidly by 0.79 ml of mesyl chloride. (10.2 mmol, 1.5 eq). The mixture is then allowed to warm to room temperature before heating for 1h at 50 ° C. 40 ml of water are then added and the mixture is extracted with dichloromethane (3 × 20 ml). The oily residue obtained after drying and evaporation of the organic phases is finally purified on silica gel (eluent: CH 2 Cl 2) to obtain a colorless oil. of the compound 3 which crystallizes in the freezer. MMR (500 MHz, CDCl3) δ 8.12 (d, 3 = 7.7 Hz, 1H), 7.93 (t, 3 = 7.8 Hz, 1H, H10), 7.70 (d, 3 = 7.8 Hz, 1H), 5.44 (s, 2H, H7), 4.01 (s, 3H, OMe), 3.15 (s, 3H, OMs), 13C NMR (126MHz, CDCl3) δ 165.33 (C13): 154.59 (s), 147.92 (s), 138.45 ( CIO), 125.41 (s), 125.13 (s), 71.11 (C7), 53.23 (OMe), 38.24 (OMs). A4) Preparation of compound 6
    Compound 6 is prepared by the method previously described, (a) WO2013011236A1; (b) Butler, BK McMahon, Pal R., Parker D., and Wallon W., Chem. Eur. 3., 2013, 19, 9511-9517.) A5) Preparation of compound 7
    360 mg of compound 6 (1.19 mmol) and 760 mg of sodium carbonate (7.15 mmol, 6 eq.) Are dried under reduced pressure in a schlenk before adding 100 ml of acetonitrile. Under argon, 710 mg of compound 3 (2.74 mmol, 2.3 eq) was added to the suspension before heating for 12 h at 70 ° C. After returning to ambient temperature, the mixture is sintered (porosity 4) and concentrated under reduced pressure. The product is purified by chromatography on alumina (activity III, eluent DCM then DCM / MeOH 96/4 v / v) to finally obtain a yellow oil of compound 7 (532 mg, yield: 80%). H NMR (500 MHz, CDCl 3) δ 7.99 (dd, 3 = 6 Hz, 2H, H 11), 7.86 - 7.65 (m, 4H, H 9), 3.98 (s, 10H, H 7 + OMe), 3.39 (d, 3 = 30Hz, 4H, H4H5), 3.11 (s, 2H, H3H6), 2.95 (s, 2H, Η3Ή6 '), 2.66 (d, 3 = 31Hz, 4H, H1H2), 1.44 (s, 9H). , boc). 13C NMR (126 MHz, CDCl3) δ 166.01, 166.09 (C13), 161.43, 161.60 (C8), 155.88 (CO (boc)) 147.45 (C12), 137.42 (d, C10), (s), 126.19,126.46 (C9), 123.70 (Cil), 79.48 (C (boc)), 63.70 (d, C7), 57.21 (C1C2), 55.37 (s), 55.11 (s), 54.67 (s), 53.04 (OMe), 50.54, 49.95 (C4C5), 28.72 (CH3 (boc)). A6) Preparation of compound 8
    In 100 ml of dichloromethane, 5 ml of trifluoroacetic acid are added to a solution of 427 mg of compound 7. After stirring for 5 hours at room temperature, the mixture is evaporated off by removing TFA with several additions of toluene. The residue obtained is purified by chromatography on alumina (activity III, eluent DCM / MeOH (gradient 1% up to 7%)). The viscous yellowish solid obtained from compound 8 is stored under argon in the freezer (mass: 315 mg, yield: 90%). NMR (500 MHz, CDCl 3) δ 7.96 (dd, 3 = 7.7, 0.5 Hz, 2H, H 11), 7.71 (t, J = 8 Hz, 2H, H 10), 7.42 (dd, 3 = 7.9, 0.5 Hz, 2H), 3.98 (d, 10H, H7 + OMe), 3.40 (t, 3 = 5Hz, 4H, H4H5), 3.03 (t, 3 = 5Hz, 4H, H3H6), 2.71 (s, 4H, H1H2). . 13C NMR (126 MHz, CDCl3) δ 165.37 (C13), 159.43 (C8), 147.59 (C12), 137.87 (C10), 126.10 (C9), 124.02 (Cil), 60.95 (C7), 54.60 (C1C2), 53.31 (OMe), 51.66 (C3C6), 46.52 (C4C5). NB: the synthesis of this compound has previously been described in the following reference: A. Nonat, C. Gateau, PH Fries, M. Mazzanti, Chem. Eur. 3., 2006, 12, 7133. A71 Preparation of Compound 9
    The ligand 9 is generated in situ by saponification of the diester 8 in the presence of sodium carbonate 32 × 03 (2 eq.) In a mixture of MeOH / H 2 O (1/1, v / v) stirred for 3 h at 50 ° C. * H NMR (500 MHz, D20) δ 7.77 (d, 3 = 7.1 Hz, 2H, H9), 7.69 (t, 3 = 7.7 Hz, 2H, H10), 7.29 (d, 3 = 7.2 Hz, 2H, H11), 3.86 (s, 4H, H7), 3.08 (t, 3 = 5.9 Hz, 4H, H4H5), 2.91 (t, 3 = 5.9 Hz, 4H, H3H6), 2.65 (s, 4H, H1H2). 13C NMR (126 "Hz, DzO) δ 173.22 (C13), 158.44 (C8), 153.01 (υ 12), 138.23 (CIO), 125.17 (Cil), 122.40 (C9), 60.27 (C7), 50.53 (C1, C2), 47.12 (C3, C6), 44.10 (C4, C5). aa) Preparation of the complex 10
    After reaction for 3 h at 50 ° C. of 110 mg of diester 8 (0.26 mmol) with 83 mg of NaiCOa (0.78 mmol, 3.0 eq.) And neutralization with HCl (IM), the disappearance of ester is verified by NMR. 96 mg of tetium chloride (0.26 mmol, 1 eq) are added to compound 9, formed in situ, before stirring the mixture for 12 hours at 50 ° C. Solubilized in a minimum of methanoi, the complex is then separated from the various salts by centrifugation. Half of the salts are removed by passage through a size exclusion column (LH20, Sephadex®, eluent: water). MS (ESI-TOF) calcd M +: 556.1003; measured: 556.0990 A91 Preparation of complex 11
    A protocol identical to that used for the preparation of the complex 10 is used with 170 mg of diester 8 (0.4 mmol) and 219 mg of Eu-13H6H 2 O (0.6 mmol, 1.5 eq). MS (ESI-TOF) calcd M +: 550.0962; measured: 550.0957. B) Preparation of a second series of triazacyclononane ligands (TACN)
    B 11 Preparation of compound 12
    15 g of chelidamic acid monohydrate (0.075 mol, leq) are dissolved in. 120 ml of thionyl chloride under argon, the suspension. is cooled to 0 ° C and 3 ml of DMF are added. The reaction mixture is then stirred for 12 hours at reflux. Volatiles are evaporated after several additions of toluene to remove its last traces of SOCb ·. The yellowish solid obtained is then dissolved in methanol and the mixture is refluxed for 12 hours to complete the reaction. After evaporation of the solvent, the residue is taken up in dichloromethane and washed successively with a saturated solution of NaHCO 3, water and brine. The organic phase is then dried over Na 2 SO 4, filtered and evaporated. The pure compound 12 is obtained by recrystallization from methanol to obtain 8.3 g of white crystalline powder. (R = 44%). NMR (300 MHz, CDCl3) δ (ppm) = 8.29 (s, 2H), 4.03 (s, 6H). B21 Preparation of compound 13
    6 g of compound 12 (0.026 mol, leq) are dissolved in 250 ml of a DCM / methanol mixture (150/100, v / v) and the solution is cooled to 0 ° C. Then, 1.09 g of NaBH4 (0.029 mol, 1.1 eq) are added all at once before stirring the mixture for 30 min: C and 30 min at RT. The reaction is stopped by the addition of 50 ml of hydrochloric acid (IM) and 100 ml of water. The organic phase is then washed with water until a pH = 7, then washed with brine, dried over Na 2 SO 4 and evaporated. The reaction crude is then purified on silica gel (eluent: DCM / AcOEt 1/1 v / v) to obtain after evaporation 1.5 g of a white powder compound 13 (R = 30%). NMR (300 MHz, CDCl3) δ (ppm) = 8.00 (bd, 1H), 7.60 (bd, 1H), 4.85 (d, J = 7 Hz, 2H), 3.99 (s, 3H) 3.48 (t, J = 7 Hz, 1H). B3) Preparation of compound 14
    1.5 g of compound 13 (7.4 mmol, 1 eq) are dissolved in 200 ml of dichloromethane and 3 ml of triethylamine are added (22.2 mmol, 3 eq.). Then 0.87 mL of mesyl chloride is added (11.1 mmol, 1.5 eq) slowly and a gradual yellow color of the mixture is observed. The progress of the reaction is monitored by TLC and stopped after 30 minutes. 100 ml of a saturated solution of NaHCO4 are added and the organic phase is then washed with water (up to pH = 7) and with brine. The organic solution is then dried over Na 2 SO 4 and evaporated to give 2 g of a yellow oil of the compound 14 used without further purification (quantitative yield). * H-NMR (300 MHz, CDCl3) δ (ppm) = 8.1 (s, 1H), 7.68 (s, 1H), 5.40 (s, 2H), 4.01 (s, 3H), 3.17 (s, 3H). B41 Preparation of compound 15
    200 mg of triazacyclononane mono-boc (0.7 mmol, leq) are suspended in 100 mL of dry acetonitrile with 420 mg of anhydrous sodium carbonate. 463 mg of compound 13 (1.75 mmol, 2.5 eq) are then added. After cooling, the mixture is sintered to remove the carbonate before evaporation of the solvent. The residue is taken up in dichloromethane and purified by chromatography on an alumina column (activity III, eluent: dichloromethane then ethyl acetate). 250 mg of a yellow solid of compound 15 (R = 63%). * H-NMR (300 MHz, CDCh) δ (ppm) = 8.00 ppm (d, 3 = 1 Hz, 1H), 7.99 (d, J = 1 Hz, 1H), 7.89 (d, J = 1 Hz, 1H ), 7.72 (d, J = 1 Hz, 1H), 3.99 (m, 10H), 3.39 (m, 4H), 3.03 (m, 4H), 2.67 (m, 4H), 1.48 (s, 9H). LC-MS: [M + H] + = 596.2 m / z. B5) Preparation of compound 16
    To a solution of 110 mg of compound 15 in 60 ml of dichloromethane, 3 ml of trifluoroacetic acid is added. The mixture is then stirred for 12 hours at room temperature. The solvent is then evaporated as well as TFA by several additions of a methanol / toluene mixture. The residue is then taken up in 50 ml of dichloromethane and washed with water until pH = 7. The organic phase is then dried over Na 2 SO 2 and evaporated to obtain 100 mg of white powder of compound 16. (R = 95%) . NMR (300 MHz, CDCl 3) δ (ppm) = 7.97 (d, J = 1 Hz, 2H), 7.54 (d, J = 1 Hz, 2H), 4.04 (s, 6H), 4.03 (s, 4H) ), 3.35 (m, 4H), 3.00 (m, 4H), 2.76 (s, 4H). 13C-NMR (75 MHz, CDCl3) δ (ppm) = 163.91, 160 (q, J = 40 Hz), 147.58, 146.99, 126.49, 125.22, 60.37, 53.80, 53.56, 53.28, 45.39. HR-MS: [M + Hf = 496.1501 m / z, theor. for C22H28O2 .IM.4O4 is 496.1513 m / z. B6) Preparation of the complex 17
    100 mg of compound "16" (0.2 mmol, 1 eq) are suspended: in "30 ml of water and 32 mg of sodium hydroxide (0.81 mmol, 4 eq) are added. The mixture is then stirred at 60 ° C. for one hour. Complete hydrolysis of the "ester" functions is confirmed by LC-MS. The solution is then cooled and its pH is adjusted to. 5 with a gradual addition of a solution of hydrochloric acid (MI). 5 ml of methanol are then added before 42 mg of sodium carbonate are added to the solution. 91 mg of TbCl 3 · 6H 2 O is added before the mixture is stirred at 50 ° C. for 12 hours. After returning to ambient temperature, the insoluble salts are filtered on sintered glass before evaporation of the solvents to obtain 300 mg of crude product. The complex is purified by size exclusion chromatography (Sephadex® LH20, eluent: water) to finally obtain 55 mg of a colorless crystalline product (yield = 44%). 1H-NMR (300 MHz, D20) δ (ppm) = 121.1, 83.90, 69.15, 52.71, 46.23, 29.58, 26.06, -0.96, -11.39, -20.2, -33.57, -36.26, -44.20, -70.35, - 91.19, -92.47, -120.84. HR-MS: M + = 624.0213 m / z, theor. for C2oH2iCl2N504Tb 624.0219 m / z. C) Preparation of a third series of triazacyclononane ligands (TACN)
    CO Preparation of compound 19
    8.3 g of compound 12 (36 mmol, 1 eq.) Are dissolved in 200 ml of acetonitrile and 54 g of sodium iodide are added (0.36 mol, 10 eq.) And 10 ml of sodium chloride are added. acetyl (0.108 mol, 3 eq.). The suspension is then placed in an ultrasonic bath for 3 hours. Then 200 ml of dichloromethane are added and the organic phase is washed with a saturated solution of sodium hydrogencarbonate. The organic phase is then washed with water to pH = 7, dried over sodium sulfate and evaporated to obtain 10.7 g of broken solid of compound 19, used without further purification (R = 92%). WMR (300 MHz, CDCl 3) δ (ppm) = 8.65 (s, 2H), 4.02 (s, 6H). C2) Preparation of compound 20
    To a solution of 10.7 g (33.3 mmol, 1 eq) of compound 19 in 200 ml of a mixture of methanol / dichloromethane (140/60) and cooled to 0 ° C., 1.39 g of sodium (36.6 me, 1.1 eq.) is added. The mixture is then stirred for 30 min at 0 ° C and 30 min at room temperature. The reaction is then stopped by adding 50 ml of a solution of hydrochloric acid (MI). The organic phase is then washed with water to pH = 7, dried over Na 2 SO 4 and evaporated. The crude product is then purified on silica gel (eluent: dichloromethane with gradual addition of methanol (0 to 10%)) to obtain 5 g of a white powder of compound 20 (R = 51%). 1H-NMR (300 MHz, CDCl 3) δ (ppm) = 8.39 (bd, 1H), 7.97 (bd, 1H), 4.82 (d, J = 5 Hz, 2.H), 3.99 (s, 3H) 3.04 (bd, 1H), t, J = 7 Hz, 1H). C3) Preparation of compound 21
    To a solution of 1 g of compound 20 (3.4 mmol, 1 eq.) And 1.4 ml of triethylamine (10.2 mmol, 3 eq.) In 120 ml of dichloromethane are added 0.4 ml of chloride. mesyl (5.1 mmol, 1.5 eq). After stirring for 30 minutes (reaction monitored by TLC), 100 ml of saturated NaHCO 3 solution are added. The organic phase is then washed with water, dried over Na 2 SO 4 and evaporated. 1.1 g of yellow oil of compound 21 is obtained and used without further purification (R = 95%). 1H-NMR (300 MHz, CDCl3) δ (ppm) = 8.48 (s, 1H), 8.04 (s, 1H), 5.38 (s, 2H), 4.00 (s, 3H), 3.16 (s, 3H). Γ41 Preparation of compound 22
    60 mg of triazacyclononane mono-boc 6 (0.2 mmol, 1 eq) are suspended in 50 ml of dry acetonitrile under argon with 140 mg of anhydrous ia2CO3 (1.2 mmol, 6 eq.). A solution of 184 mg of compound 21 (0.5 mmol, 2.5 eq) in dry acetonitrile is then added and the mixture is stirred for 12h at 60 ° C under argon. After cooling, the mixture is sintered and evaporated. The residue is taken up in dichloromethane and purified on a column of alumina (activity III, eluent: dichloromethane and then ethyl acetate) .Only 110 mg of pure compound 22 are obtained in the form of a pasty white solid (R = 71%). NMR (300 MHz, CDCl3) δ (ppm) = 8.34 (s, 2H), 8.22 (s, 1H), 8.11 (s, 1H), 3.97 (s, 6H), 3.94 (s, 4H), 3.4 -2.58 (m, 12H), 1.47 (s, 9H). UC-NMR (75 MHz, CDCb) δ (ppm) = 164.6, 162 (d, .3 = 14 Hz), 155.61, 147.6 (d, 3 = 14 Hz), 135.3 (d, 3 = 14 Hz), 132.7 , 106.6, 79.5, 63.1, 56.6, 54.9, 54.4, 53.1, 50.8, 50.2, 28.7. LC-MS: [M + Hf = 780.0 m / z. C51 Preparation of compound 23
    110 mg of compound 22 (0.14 mmol, 1 eq) are dissolved in 50 ml of dichloromethane, and then an excess of trifluoroacetic acid is added (3 ml). The mixture is then stirred at ambient temperature for 12 hours. The solvent is then evaporated and a mixture of 20 mL of dichloromethane and 10 mL of water is added. The aqueous phase is neutralized by adding a saturated solution of NaHCO 3 and extracted with dichloromethane. The combined organic phases are dried over sodium sulphate and evaporated. 100 mg of white solid (quantitative yield) of the compound 23 is obtained which is used without further purification. 1H-NMR (300 MHz, CPCI3) δ (ppm) = 8.23 (s, 2H), 7.83 (s, 2H), 3.92 (s, 10H), 3.27 (s, 4H), 2.92 (s, 4H), 2.67 (s, 4H). 13C-NMR (75 MHz, CDCl3) δ (ppm) = 164, 159.98, 147.81, 134.86, 133.14, 107.08, 59.85, 53.36, 52.65, 49.87, 45.33. HR-MS: [M + H] + = 680 m / z, theor. for C22I2H28N2O5 680.0225 m / z. C6) Preparation of the complex 24
    100 mg of compound 23 (0.15 mmol, 1 eq) are suspended in 30 ml of water and 24 mg of sodium hydroxide (0.81 mmol, 4 eq) are added. The mixture is then stirred at 60 ° C for 1 h. Complete hydrolysis of the ester functions is confirmed by LC-MS. The solution is then cooled and its pH is adjusted to 5 with a gradual addition of a solution of hydrochloric acid (MI). 5 mL of methanol is then added before 42 mg of sodium carbonate is added to the solution. 66 mg of TbCl3, 6H20 (0.18 mmol, 1.2 eq) are added before stirring the mixture at 50 ° C for 12h. After returning to ambient temperature, the insoluble salts are filtered on sintered glass before evaporation of the solvents to obtain 200 mg of crude product. The complex is purified by size exclusion chromatography (Sephadex® LH20, eluent: water) to finally obtain 36 mg of a colorless crystalline product (yield = 30%). H-WMR (300 MHz, D20) δ (ppm) = 122.8, 84.95., 82.17, 70.62, 49.22, 25.03, 20.8, -0.89, -8.54, -19.41, -33.05, -41.19, -67.6, -88.49 , -90.57, -125.1. HR-MS: [M + Hf = 807.8921 m / z, theor. for CzoHziIzNsC ^ Tb 807.8931 m / z. D) Preparation of a fourth series of triazacydononane ligands (TACN)
    DU Preparation of compound 25
    1 g of compound 2 (6 mmol, 1 eq.) Is dissolved in 100 ml of methanol and 8 ml of a 30% aqueous ammonia solution (60 mmol, 10 eq.). This mixture is stirred at ambient temperature for 12 hours. The solvents are then evaporated to 900 mg of a pure white solid (R = quantitative). NMR (300 MHz, CzDeSO) δ (ppm) = 8.14 (bs, 1H), 7.96 (t, J = 8 Hz, 1H), 7.88 (d, J = 8 Hz, 1H), 7.61 (bd, 1); = 8 Hz, 2H), 4.64 (s, 2H). LC-MS: [M + H] + = 153.2 m / z. D2) Preparation of compound 26
    To 1 g of compound (6.6 mmol, 1 eq) in 20 ml of DMF at 0 ° C, 4 ml of thionyl chloride (53 mmol, 8 eq) are added. The mixture is stirred for 2 hours, before being allowed to return to room temperature in 15 minutes. 150 ml of water are then added, before extracting the product with 30 ml of dichloromethane. The organic phase is then washed with water until a pH = 7, then washed with brine, dried over [a] 2 SO 4 and evaporated. The residue obtained is. purified by chromatography on silica gel (eluent: dichloromethane) and gives 720 mg of a white solid of compound 26 (R = 55%). XH-NMR (300 MHz, CDCl 3) δ (ppm) = 7.89 (t, J = 8 Hz, 1H), 7.75 (d, J = 8 Hz, 1H), 7.65 (d, J = 8 Hz, 1H), 4.69 (s, 2H). LC-MS: [M + H] + = 153.3. D3) Preparation of compound 27
    120 mg of mono-Boc-protected triazayclononane (0.4 mmol, 1 eq) are dissolved in 50 mL of dry acetonitrile under argon with 252 mg of anhydrous Na 2 CO 3 (2.4 mmol, 6 eq). A solution of 151 mg of compound 26 (1 mmol, 2.5 eq) in dry acetonitrile is then added and the mixture is stirred for 12h at 60 ° C under argon. After cooling, the mixture is sintered and evaporated. The residue is taken up in dichloromethane and purified on an alumina column (activity III, eluent: dichloromethane then ethyl acetate) .Niomethyl compound (160 mg) is obtained in the form of a pasty white solid (R = 83%). H-NMR (300 MHz, CPC13) δ (ppnn) = 7.79 (dt, 3J = 8 Hz, 4J = 1 Hz, 2H), 7.70 {bd, J = 8 Hz, 2H), 7.57 (dt, 3J = 8 Hz, 4 J = 1 Hz, 2H), 3.91 (s, 4H), 3.36 (m, 4H), 3.03 (m, 4H), 2.66 (m, 4H), 1.47 (s, 9H). LC-MS: [M + Hf = 462.2 m / z. D4) Preparation of compound 28
    To a solution of 160 mg of compound 27 (0.35 mmol, 1 eq) in 40 ml of dry DMF under argon, 225 mg of NaN 3 (3.5 mmol, 10 eq) and 185 mg of dry NH 4 Cl are added. . The mixture is stirred at reflux at 120 ° C for 12 h. After cooling, sintering and evaporation of the solvents, a residue is obtained, which is taken up in 50 ml of hydrochloric acid (MI) and placed in an ultrasonic bath for 2 hours. HR-MS [M + H +]: 604.1439 th 604.1447 D5) Preparation of compound 29
    155 mg of compound 28 (0.35 mmol, 1 eq) are suspended in 10 ml of water with 220 mg of Na 2 CO 3 (2.08 mmol, 6 eq). After stirring for 10 minutes, 155 mg of TbCl3 * 6H2O (0.42 mmol, 1.2 eq) are added. The solution is then stirred for 12 hours at room temperature. After evaporation of the solvents, the crude product is purified on a size exclusion column. (Sephadex ® LH20 in water) to finally obtain 40 mg of crystalline white solid (yield = 20%). HR-MS: [M + H] + = 604.1439 m / z, theorem for C20H23NoTb 604.1427 m / z. E) Preparation of a first series of ligands based on 1,7-ΰϊοχ3-4,10-diazacyclododecane
    The compound 31 'is prepared according to the method previously reported (M. Mato-Iglesias, Adrién Roca-Sabio, Z. Pélinkés, D. Esteban-Gomez, C. Platas-Iglesias, E. Tôth, A. de Blas, T. Rodrtguez-Bias, Inorg Chem., 2008, 47, 7840).
    Part II: Crystallographic studies A) Protein models studied 5 proteins, of which three commercial proteins were selected. The structure of these five proteins was known. These five proteins were chosen because of their physicochemical differences. Indeed, they belong to various organisms, have broad thermal properties and an oligomeric state ranging from monomer to hexamer, Tests, with proteins whose structure is unknown, have also been made, a. Commercial proteins
    The three commercial proteins selected are lysozyme. chicken egg white (HEWL), Thaumatine Thaumatococcus danielti and Tritirachium Proteinase K album. These three proteins are model proteins in crystallogenesis. They are bought in freeze-dried form. They were solubilized in milliQ water just before crystallogenesis experiments at the desired concentration. They are presented in Table 1 below.
    Table 1: Commercial Proteins Used and Associated Supplier
    The conditions of native crystallization (that is to say without adding complex according to the invention) of these proteins are known and described in Table 2 below. These conditions have been used to characterize the effect of the lanthanide complexes according to the invention on the crystallogenesis of these commercial proteins.
    Table 2: Usual Crystallization Conditions for Commercial Proteins a. Non-commercial proteins
    The two non-commercial proteins (known structures) are Pyrococcus horikoshii Protease 1 and Pyrococcus furiosus Glyoxylate hydroxypyuvate reductase. These two proteins were purified according to the protocols described in the references below: - Purification protocol of the. Proteinase 1 protein. P, horikoshii; Xinlin Du et al. Crystai structure of an intracellular protease from Pyrococcus horikoshii at 2-A resolution. 2000. Vol97. No. 26. PNA8. - Protocol for the purification of the P. furiosus Glyoxylate reductase protein: Thesis of Louise Lassa lie, defended on December 19, 2014 in Grenoble: Molecular bases of piezophilia adaptation: structural and biochemical studies of key metabolic enzymes from archaea and isolated bacteria in the seabed. Link: htto: /./ www.theses.fr/s98711.
    The technical details concerning these proteins are given in Table 3 below:
    Table 3; Characteristics of Non-commercial Proteins Used GRHPR Sequence: SEQ ID No. 4 Sequence of Protease 1: SEQ ID NO: 5
    The crystallization conditions of these two proteins are described in Table 4 below. These conditions make it possible to crystallize the proteins in their native form and are extracted from the same references as the purification protocols.
    TABLE 4 Crystallization conditions of non-commercial proteins used The five proteins described above are the reference proteins for characterizing the effects of lanthanide complexes. c. Unknown proteins
    The specificities of the three proteins whose structure is unknown are described in Table 5 below. The structure of the MDH-ANC80 protein has been determined by means of the lanthanide complex 17. The various steps will be described individually in a dedicated section,
    Table 5: Characteristics of proteins of unknown structure on which the lanthanide complexes according to the invention were tested Sequence of the Pb6: SEQ ID No. 6 Sequence of the MDH: SEQ ID No. 7
    No crystallization condition was published for these two proteins.
    The ANCSO malol dehydrogenase (MDH) purification protocol is described in the literature (Madem et al., 1995 230 (3): 1088-95 Eur 3. Biochem).
    The purification protocol of pb6 was established by the team of Cécile Breyton of the M & P group of the Institute of Structural Biology and is as follows:
    Protocol of · .purification: ob6:
    Expression system = E. coli BL21 (DE3) transformed with LIM1 (Kan R) His tag with cleavage site "Tobacco Etch Virus". Preculture classical LB medium with 50 μg / ml kanamicyne Culture in conventional medium LB: Seeding with an optical density of 0.1 and 50 μg / ml of Kanamicyne. -After 6 hours of culture, centrifugation 30 minutes 4000rpm
    - Bacteria freezing at -80 ° C - Cassage - Resumption in lysis buffer 50mM Tris pH 8, 150mM NaCl, 2mM MgCI2 in precence of anti-protease and DNase - Lysis of bacteria with microfluidizer 6x 12000psi - Centrifugation: 20 minutes at 14,000 rpm - Nickel Affinity Column
    Equilibration Buffer = 20 mM Tris pH 8, 250 mM NaCl, 15 mM Imidazole
    Elution buffer = 20 mMTris pH 8, 200 mM Imidazole Flow = Iml / ml - Dilution of elution fractions to the fifth with distilled water to decrease the conductimetry. - Ion exchange column (HT Q lml)
    Equilibration Buffer = 20 mM Tris pH 8 Elution Buffer = 20 mM Tris pH 8 IM NaCl Linear Gradient Elution Flow Rate = 1 ml / min Concentration on Concentrator with 30kDa Membrane - Desalting by Gel Filtration in Tris pH Buffer 8 20 Mm B) Automated Crystallization / Stability of Lanthanide Complexes a. The HTXIab platform.
    In order to determine the crystallization conditions of a protein, the HTXIab platform for screening a wide range of crystallization conditions was used. These conditions are all described in the Tables in Appendix 2A and 2B and from https://embl.fr/htxlab/index, php GptiQn = comj: have &v; ew = artide & id = 38Mter ™ d = 172. ^ · ·
    Conventional screening consists of 6 crystallization plates of 96 wells each, or 576 conditions.
    The studies performed on the MDH-ANC80 and Pb6 proteins used the conditions described in Appendix 2A.
    The studies carried out on the other proteins were carried out with the conditions described in Appendix 2B, due to a change due to the supplier. Stability of complexes
    The stability studies were performed with the conditions described in Appendix 2A. It has been shown that lanthanide complexes based on tris-dipicolinate (DPA) [Ln (DPA) 3] 3 'exhibit "auto-crystallization" for certain crystallization conditions. In particular, the presence of divalent cations, high concentrations of salts, the presence of MPD caused self-crystallization of this type of complex (PhD thesis of R. Talon supported in Grenoble on June 6, 2012). Two concentrations of Ln (DPA) 33 'were evaluated (25 and 100 mM). Thus, on 576 conditions, more than a quarter of the conditions lead to self-crystallization / formation of Ln (DPA) precipitates 33 'to 100 mM and of the order of 8% when used at 25 mM.
    Equivalently, the stability of the complex 10 was evaluated at 3 different concentrations (10, 50 and 100 mM). Complex 10, even at a concentration of 100 mM, exhibits increased stability. Indeed, no crystal of the complex was observed, as detailed below where only the presence of precipitates was detected. Recapitulation of the screening of 6 conventional plates for 100 mM of complex 10: Hampton plate 3 Slight precipitation observed in the presence of NaHPO 4 or KHPO 4.
    Hampton Plate 5
    Mostly PEGs in this case 100% of the drops are clear.
    Hampton Plate 4
    Mostly salts. Some conditions are redundant with your Hampton 3 plate. Similar effect in the presence of HP04 'with slight precipitation observed.
    Qiagen Plate 1 Mix PEGs, salts and metals. A slight precipitate is observed in the presence of cadmium acetate.
    Hampton plate 6 Light precipitate observed in the presence of a mixture of metals (cadmium, zinc, cobalt).
    Hampton Plate 2 Light precipitated in the presence of NaF and (NH4) 2PO4 The following are the conditions that lead to these precipitates:
    With 100 mM of complex 10 added under standard conditions:
    Hampton Plate 4: 21 Precipitated Conditions No. A7, B7, C7, A8, B8, ABCD 9, 10, 11 and 12 (Majority Ammonium Phosphate)
    Hampton 5 plate: No precipitate
    Quiagen plate 1: 6 precipitated conditions No. D6, B9, F9, F9, D10, E10
    Hampton Plate 6: 4 Precipitated Conditions No. A3, B3, C3, H8
    Hampton Plate 2: 7 Precipitated Conditions No. Cl, C5, B6, kl, Cl, kll, B12
    Hampton Plate 3: 4 Precipitated Conditions # H3, E4, A6, E5
    That is a total of 42 conditions with precipitates. On a screen of 576 conditions this equates to 7.3%;
    No false positives as with the DPA.
    With 10 mM complex 10 added under conventional conditions:
    Hampton plate 4: No precipitate marked as observed with 100 mM some trace of precipitate for ABCD line 12
    Plate Qiagen 1: E10 a slightly hasty condition
    Plaque wizard I and II rigaku 5 precipitated conditions No. E6, C7, B9, CIO, Hll
    JCSG Plate: 3 slightly hasty conditions # D2 G5, A6
    Qiagen PACT Plate: 5 Precipitated Conditions No. El, A5, A6, Eli, C12
    Qiagen PEG plate: No conditions precipitated
    That is a total of 18 conditions with slight traces of precipitates. (3.2% of the screen) knowing that drops with some traces of precipitate have been qualified as "precipitate". The amount and number of precipitating tests have nothing to do with the precipitates observed at 100 mM complex 10 or at 25 mM Ln (DPA) 33-.
    It should be noted that the presence of these precipitates is not incompatible with the appearance of protein crystals. Indeed, manual crystallization tests of the C. aurantiacus MDH protein in the presence of cadmium made it possible to obtain crystals in the presence of 50 mM of complex 10. C) Screening of new crystallization conditions
    To screen six plates on the HTXIab platform, 100 μl of protein solution is needed. In order to have a direct comparison, the native protein (without the ianthanide complex) and the protein in the presence of 10 mM complex were screened in parallel in the same crystallization plates. at. Protocol for the preparation of protein samples containing the lanthanide complex.
    The lanthanide complexes were stored as a powder at 4 ° C. The mass corresponding to 10 mM per 100 μl of protein solution was weighed on a precision balance. The powder was centrifuged to pellet. This pellet was taken up in 100 μl of the protein solution. A two-minute centrifugation was performed to remove any aggregates. The solution was then changed from tube. This protocol was applied for all the proteins sent to the robot. b. Determination of new condition for the unknown protein ob6
    The most interesting conditions in terms of crystallogenesis and allowing the crystallization of pb6 are listed in Table 6. The conditions which allowed the formation of crystals only in the presence of 10 mM complex 10 are mentioned in bold (it is pb6 -l and pb6-4).
    Table 6: Crystallization conditions for the protein pb6 obtained with the HTX robot in the absence or in the presence of complex
    Condition pb6-l was reproduced manually in the laboratory and also gave crystals. The use of the complexes according to the invention makes it possible to double the number of conditions which led to crystallization. c. Determination of new conditions for the unknown protein MDH-ANC80 The most interesting conditions in terms of crystallogenesis and allowing the crystallization of the protein ANC80 are listed in Table 7,
    The conditions which allowed the generation of crystals only in the presence of 10 mM complex are mentioned in bold (it is ANC-1 and ANC-2).
    TABLE 7 Crystallization conditions for the protein ANC8δ obtained with the HTX robot in the absence or in the presence of complex
    The condition ANC-1 was reproduced in the laboratory and allowed the growth of crystals (Da Paragraph). The use of the complexes according to the invention makes it possible to triple the number of conditions which led to crystallization, d. Statistics for obtaining crystals of the different proteins studied on the HTXIab platform
    In Table 8 below, the number of conditions which led to crystals after conventional screening (from 576 commercial conditions for complex 10 and 480 for complex 31) on the HTXIab platform of the different proteins studied is presented. The values indicated correspond to an observation of the crystallization plates after 85 days. The column "unique conditions" corresponds to the number of conditions which lead to crystallization in the presence of complex, but no crystallization in the same conditions in the absence of complex (so-called native).
    Table 8 * Condition leading to crystallization in the absence of complex (native conditions) ** Condition leading to crystallization with addition of complex
    The conditions leading to crystallization correspond to conditions leading to the appearance of potentially exploitable crystals for diffraction experiments. Thus, the complex 10 allows the significant increase in the number of crystallization conditions for the following proteins: HEWL and Pho proteasel. If its effect may seem less effective in the case of proteins
    Proteinase K and Thaumatin, it is not so. Indeed, the introduction of complex 10 does not lead to a significant increase in the number of ianthanide hits, but the conditions obtained are largely different from the native conditions (21 for proteinase K and 2 for Thaumatin). The number of potential conditions for obtaining crystals of the protein of interest is therefore increased.
    It should be noted that in the case of the Proteasel protein with the complex 10, obtaining 113 conditions covers a wide range of different crystallization conditions. This again proves that the complex 10 is compatible with all the physico-chemical conditions that can be encountered in commercial crystallization kits.
    Complex 10, like complexes 17 and 31, all have a nucleating character. However, the complexes 17 and 31 are less effective than the complex 10. For example, the complex 31 seems less effective than the complex for the proteinase K. However, the 4 conditions which led to crystallization, in the presence of the complex 31, are different from those leading to native crystals. These crystals are potentially of better quality. Obtaining new conditions leading to crystallization is therefore a step forward. D) Crystallizations made manually in the laboratory
    The commercial proteins (Paragraph Aa) were manually crystallized according to the usual known crystallization conditions (Table 2). The crystallization conditions described in Table 2 were therefore reproduced in the presence of complexes 10 or 17 at a concentration of 10 mM. To carry out these manual crystallization ranges, the crystallization drops were prepared according to the following scheme: 1.5 μΙ of protein solution + 1.5 μl of complex solution at a concentration of 10 mM + 1.5 μl of precipitant solution. In order to highlight a potential effect of the lanthanide complexes on crystallization, the range of precipitating agent was adjusted so as to be at the limit of the crystallization zone, and then possibly extended beyond when an effect was observed. .
    Thus, in the case of the lysozyme protein, a marked nucleating effect has been observed. The nucleating effect here must be understood as the growth of crystals in the presence of the lanthanide complex at low precipitation concentrations, which do not allow the formation of native crystals. In order to clearly demonstrate this phenomenon of nucleation induced by the complexes according to the invention, phase diagrams have been made by determining the concentration ranges of precipitating agents and protein which make it possible to obtain crystals. at. Phase diagrams for lysozyme of native chicken egg white and in the presence of 10 mM complex or complex 17
    The phase diagrams of the lysozyme protein obtained after 2 days and 15 days of growth are shown in FIG.
    Each crystallization condition was carried out in triplicate. After only two days of crystal growth, a clear difference was observed. In the presence of complex 10 or 17, crystals were obtained at low concentrations of protein (5 mg / ml) and precipitating
    After 20 days of crystal growth in the presence of complex 10 or 17 to 10 mM, crystals were obtained over the entire range evaluated. In particular, crystals appeared for 5 mg / ml of lysozyme and for a precipitating concentration of 500 mM. In comparison, the absence of lanthanide complex only allows the formation of crystals up to 500 mM NaCl and for concentrations of 20 mg / ml protein. To compare :
    The MRI type complexes, which do not induce nucleating effects, are conventionally used at concentrations of the order of 50-300 mM. Lanthanide tris-di-colinate produced a new crystalline form of lysozyme only when used at concentrations above 50 mM. The MIPs proposed by IMaomi E. Chayen (Saridakis, E., Khurshid, S., Govada, L., Phan, Q., Hawkins, D., Crichlow, GV, Lolis, E., Reddy, S, M. , & Chayen, NE (2011) Proceedings of the National Academy of Sciences, 108, 11081-11086) lead to offsets of the crystallization zone of only one to two units of concentration of precipitating agents. The associated nucleating effects are only obtained for conventional lysozyme concentrations of the order of 30 mg / ml (Khurshid et al., Automating the Application of Smart Materials for Protein Crystallization, (2014) Acta Crystals D). According to Saridakis et al. (Saridakis, E., Khurshid, S., Govada, I., Phan, Q., Hawkins, D., Crichlow, GV, Lolis, E., Reddy, SM, & Chayen, NE (2011). National Academy of Sciences, 108, 11081-11086.), the crystallization range of lysozyme in the presence of their nucleating agents starts from 480 mM NaCl for a protein concentration of 20 mg / mL. No lysozyme crystals were observed below 460 mM NaCl. Regarding the thaumatin protein (30 mg / ml) no crystal is observed below 0.2 M tartrate. In the presence of their nucleating agents, they obtain crystals for 0.3 and 0.4 M tartrate (idem complex 10) and native crystals for 0.5 M tartrate. POM-type complexes have a nucleating effect only with high concentrations of lysozyme (of the order of 100 mg / ml), which poses problems of solubility for most proteins. (A. Bijelic et al Hen Egg-White Lysozyme Crystallization: Protein Stacking and Structure Stability Enhanced by a Tellurium (VI) -Centred Polyoxotungstate ChemBioChem 2015, 16, 233-241). b. Phase diagram for Ivsozvme of native hen egg white and in the presence of 10 mM complex 11 (Eu)
    The phase diagram obtained in the presence of complex 11 (FIG. 6) is equivalent to that obtained in the presence of complex 10. The nature of the ilanthanide present within the complex does not influence the observed nucleating effect. c. Phase diagrams for the unknown structural protein ob6
    The pb6 protein was purified according to the protocol described above. The condition pb6-l (Paragraph Cb) obtained with the robot HTXIab was reproduced manually. Phase diagrams have been determined. They are represented in Figure 7. As for lysozyme, the nucleating effect is very important. The crystals obtained in the presence of the lanthanide complex according to the invention are very promising (see FIG. 8) for a crystallographic study.
    The crystals obtained in the presence of 1 mM of complex lu are perfectly usable for diffraction experiments. The native crystals are too small, too thin and poorly organized. Thus, in the case of the pb6 protein, both a nucleating and crystallizing effect induced by the compound 10, d, are observed. Crystallizing effect of lanthanide complexes
    If an improvement of the crystallization (number of crystals, size of the crystals, improvement of the diffraction) is observed by the addition of lanthanide complex, one speaks then of crystallizing effect
    In the case of the crystallization of the P. horikoshii Protease 1 protein, a crystallizing effect has also been observed linked to the addition of the complex 10. In fact, the crystals obtained in the presence of 10 mM of complex 10 appeared on average 2 , 5 times larger than the crystals obtained under the same conditions, but without complex (average size evaluated on 10 crystals present in a photographed drop).
    This crystallizing effect is therefore of particular interest for X-ray crystallography since the diffracted intensity is proportional to the X-ray crystallography. volume of the irradiated sample. Ceia can thus make it possible to obtain a higher resolution for the diffraction data. E) Luminescence properties and applications
    The coordination complexes of terbium and europium (III) are known to exhibit very particular luminescence properties, due to ff transitions which result in fine and characteristic emission lines of each element and long lifetimes. (ps-ms). It is difficult to induce this luminescence by direct irradiation of the metal ion, because these transitions ff are forbidden and therefore have very low molar absorption coefficients. On the other hand, it is possible to sensitize this luminescence by an indirect process, called an antenna effect, which consists of exciting an organic ligand containing a chromophore (typically an aromatic group) and of transferring this energy onto the metal ion (Luminescence of Lanthanide Ions in Coordination Compounds and Nanomaterials, Ed. A. De Bettencourt-Dias, Wiley 2014).
    These luminescence properties of the proposed lanthanide complexes can be exploited in two steps of determining the structure of a protein; a) the detection of crystals during crystallizations and b) during the centering of the crystals during the diffraction experiment. at. Detection of crystals during crystallizations
    The detection of the crystals can sometimes be complicated, for example when the crystals are of small sizes, are embedded in precipitate or are obtained at the crystallization drop edge. In the particular case of membrane proteins, one can also cite the problem of the detection of crystals obtained by the technique of crystallization in cubic phase of lipids.
    To improve the detection of crystals, many suppliers offer microscopes with a UV source, making it possible to use the intrinsic fluorescence of aromatic amino acids, in particular tryptophan. By way of example, mention may be made of the UV source proposed by Molecular Dimension (http://www.moleculardimensions.com/applications/upload/Xtalight_100.pdf) or the UVEX microscope (http: //www.moleculardimensîons.com/ shopdisplayproducts.asp id = 299 & cat = UVEX + UV + Fluorescence + Imaging + Systems) offered by the same company. The use of the luminescence of lanthanide complexes can help solve many of the problems mentioned above.
    The luminescence of the lanthanide complexes according to the invention was therefore studied, using a UV source on the market by the company NatXray on a conventional microscope and an external UV LED source from OceanOptics (FIG. 9; Wavelength). 365 nm excitation model (LLS-365 model; http: //oanoptics.com/product/lls-family/) (lysozyme crystals obtained in the presence of IQmM of the complex or crystals of the MDH ANC80 protein obtained in the presence of 50mM of complex 17). With the aid of the NatX-ray system, the crystals obtained in the absence of the complex 10 appear blue (left). Conversely, those obtained with this complex appear green (right), which results in an increase in the contrast between the crystals and the solution surrounding them. This is also observable with the system using a UV LED source, since the crystals obtained in the presence of the complex 17 and under UV illumination are more easily identifiable than when they are observed in white light. For example, a small crystal is indicated by a white arrow (Figure 9).
    It will further be noted that the luminescence is observable for two excitation wavelengths (280 nm and 365 nm). b. Crystal centering aid
    This part was evaluated using the CRYOBENCH instrument of the IBS-ESRF (http://www.isbg.fr/analyses-structurales/crvObench/) and on the light line FIP-BM30A of the ESRF.
    The crystals used (lysozyme crystals obtained in the presence of 10 mM complex or MDH ΔNC8G protein crystals obtained in the presence of 50 mM complex 17) were conventionally frozen at 100 K on nylon loops.
    For., Take pictures, the same UV source .LEO · external of ... the company OceanOptis has, summer. used. The quality of the photos obtained allows to consider various means of facilitating the centering: a direct centering by means of luminescence, the use of a spectrophotometer to accurately measure the luminescence and to search for the areas with the lowest intensities. The idea would be to scan the loop with a thin UV beam - Perform a pre-positioning thanks to the luminescence, completed by a precise centering by the so-called Raster technique. scanning (Aishima et al., Acta D (2010), D66, 1032-1035), in particular in the case of small-size or fine-needle crystals, F) phasing potential of the lanthanide complexes according to the invention. The evaluation of the phasing potential of the lanthanide complexes according to the invention was carried out in a conventional manner, using different de novo methods for determining the phases, representing a panel of techniques commonly used for the determination of structures of biological macromolecules. This shows that the use of the complexes according to the invention allows a usual use of phasing methods.
    The methods tested are: • the SAD method, which has the advantage of requiring a single crystal and making a single diffraction recording, • the MAD method, which has the advantage of requiring a single crystal, which supposes a recording at several wavelengths and which theoretically produces better quality phases than the SAD method, • the SIRAS method, which supposes a recording on a crystal of the protein in the absence of a complex and a recording on a crystal of the protein in the presence of complex. This method assumes an excellent isomorphism of the two crystals and therefore requires that they have the same crystalline form.
    The diffraction data has been integrated and scaled with the XDS, SCALA and TRUNCATE programs.
    The program AutoSharp (https://www.qlobalphasmo.com/sharp/Ya) has been used, which automatically searches for the position of the heavy atoms, their refinement, the initial determination of the phases, as well as their improvement. The program was used with the default parameters.The phasing result is evaluated on the basis of merit figures (FOM for "Figure of Merit"), before and after phase improvement ...
    In a second step, the quality of the phasing was evaluated by carrying out an automatic reconstruction of the model of the considered protein. The number of residues modeled on the expected number of residues is then available. The. Buccaneer program (http://www.ccp4.ac.uk/dist/html/cbuccaneer.html).a:was used with the default settings and with 10 rebuild cycles.
    With regard to obtaining the diffraction data, these have been conventionally recorded on a synchrotron light line ... In order to accurately determine the absorption threshold Lm of the ianthanide used, a measurement of fluorescence was performed and treated. using the Chooch program (http://www.gwyndafevans.co.uK/chooch.html). The recording wavelengths are thus obtained, in order to optimally exploit the signal. Ianthanide anomaly (SAD and MAD methods). In the case of the SIRAS method and in addition to the recording at the threshold Lm of the lanthanide on the derived crystal, a recording on a native crystal was made at the wavelength of 0.9798 Å. The results are shown in Figure 10
    For each of the evaluated phasing methods, recordings were made at the wavelengths shown in Table 9:
    Table 9: Methods of phasing used and associated recording energies, b. Diffraction test of crystallized proteins in the presence of 10 mM complex 10: or 17
    Crystals of proteins co-crystallized in. The presence of 10 mM complex 10 or 17 (lanthanide complex nucleant effect condition) was evaluated in terms of diffraction and the results of this assessment are summarized in Table 10:
    TABLE 10 Results of Diffraction Tests Obtained on Different Crystallized Proteins in the Presence of Lanthanide Complexes
    In the case of the Protease 1 protein, the crystallizing effect is manifested as well by an increase in the mean crystal size, as previously indicated, as well as by the obtained resolution for diffraction. recorded on a crystal obtained in the presence of 10 mM complex · have a resolution of 1.7 A. The best model · currently available in the Protein Data Bank is 2.0 Â (PDB Code: 1G2! Reference publication: idem protocol part 1b) C. De novo Phasaae of Model Proteins The structures of the different model proteins were determined according to the different methods explained in the paragraph.
    In addition, the phasing attempts were made on crystals obtained under nuciating conditions of the complex (that is to say at 10 mM), but the possibility of dipping a crystal obtained in the presence of 10 mM. complex 10 or 17 in a solution similar to the crystallization condition and containing 100 mM of complex of. lanthanide has also been studied. This was intended to eventually increase the rate of tagging. protein and thereby facilitate the determination of structure. The soaking time was of the order of a minute. It should be noted that this soaking technique can also be applied to crystals (obtained in the absence of lanthanide complex).
    In summary, the following three methods for the preparation of the following crystals have been evaluated for a transient phasing using the lanthanide complexes according to the invention: crystal-crystallized in the presence of complex (nucleating condition); crystal co-crystallized in the presence of 10 mM complex and quenched in a solution containing 100 mM of the same complex, native crystal dipped in a 100 mM solution of the lanthanide complex. The set of diffraction data was obtained in accordance with the methodology explained in paragraph F. The results are shown in Table 11 below.
    Table 11: De novo Phase Results for Model Proteins * Soaking: In a cryoprotectant solution containing 100 mM of complex
    The high phasing power of the object complexes of the present invention is reflected in the percentage of model reconstructed in manual intervention. The more the phase determination is of quality (which depends on the phasing method used, the occupation of the complex fixation sites, the quality of the data, etc.) the more the experimental electronic density map will be interpretable by the automatic rebuilding programs (such as the Buccaneer program). In the evaluated cases, automatically reconstructed models of the order of 50% to almost 100% of the final model were obtained. d. Examples of electron density obtained after phasing and solvent flattening
    An example of an experimental electron density obtained according to the methods described above for the glyoxylate reductase protein and for the Protease 1 protein are illustrated in FIG. 11. The glyoxylate reductase crystals were obtained according to the conditions described in Table 4 in the presence of 10 mM of complex 10. The crystals of the Protease 1 protein were obtained according to the conditions described in Table 4 in the presence of 10 mM complex and then soaked in a cryoprotectant solution containing 100 mM complex 10.
    In both cases, taking into account the quality of the determination of the phases, one obtains experimental electronic density maps easily interpretable, where one distinguishes the lateral chains of the amino acids. A tyrosine for the map of glyoxylate reductase and a tryptophan for the Protease 1 protein map. The images were produced using the coot software. G) Application of 1a. technology for determining the structure of the MDH protein ANC80 a. Nucleating and crystallizing effect: the case of the MDH ANC80
    The PAWC8Q MDH protein concentrated at 10 mg / ml was sent to the crystallization robot for conventional screening of the 576 conditions. The most promising crystallization condition is the ANC-1 condition of Table 7. The photos obtained in the crystallization robot for this condition are shown in Figure 12.
    This condition has been reproduced manually in the laboratory. Crystals appeared in the presence of 10 mM complex 17 and 10 mM complex in 7 days. The same condition in native condition (without lanthanide complex) was also realized. After about 3 weeks, crystals of different shapes appeared (not shown).
    The native crystals were diffracted. This has a resolution of the order of 2.5 Å. These crystals have a symmetry different from that obtained for the crystals obtained in the presence of complex 10 or 17 (space group F2.22) with mesh parameters of the order of 81, 140 and 395 Å respectively for a, b , and c. This is to be compared to the space group obtained for the crystals in the presence of complex and the resolution obtained for the diffraction data. Indeed, the crystals in the presence of 10 mM lanthanide complex diffract at 1.7 Angstrom. Thus, the nucleating and crystallizing effects are well observed in the case of this protein.
    The determination of the structure of the MDH of the ANCSO was carried out according to the MAD method. Three sets of data were recorded on the same crystal at the absorption threshold Lra of terbium. An additional dataset was measured at the K absorption threshold of selenium to obtain the best possible resolution. The statistics, after integration on all the data collected, are presented in Table 12 below.
    Table 12 .. Collection of data, phasing and refinement statistics * according to Figure 8, ... The refinement of the model leads to very good quality factors with a factor R and Rfree of 19.2 and 21.2% ..
    The following luminescent complexes were also tested at 10 mM and show no effect on crystallization:
    APPENDIX 1: Amino Acid Sequence of the Different Proteins Tested
    Lysozyme (Gallus gallus) HEWL: SEQID N ° 1
    KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSR
    WWCNDGRTPGSRNLCNIPCSALLSSDÎTASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQ
    AWIRGCRL
    Thaumatin (T. danielli): SEQ ID NO: 2
    ATFEIVNRCSYTVWAÂASKGDAALDAGGRQLNSGESWTTNVEPGTNGGKIWARTDCYFDDS
    GSGICKTGDCGGLLRCKRFGRPPTTLÂEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVR
    CAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKP
    TWTCPGSSNYRVTFCPTA
    Proteinase K (Tritirachium Album): SEQ ID NO: 3
    AAQTNAPWGIARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSS
    RDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCP
    KGWASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRY
    DRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACR
    YIADTANKGDLSNIPFGTVNLLAYNNYQA
    Hydroxypyruwate reductase glyoxylate (P. furiosus): SEQ ID NO: 4
    MKPKVFITRAIPENGINMLEEEFEVEVWEEEREIPREKLLEKVKDVDALVTMLSERIDQEVFENA
    PRLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTNATADHAFALLLATARHWKGDKFVRS
    GEWKRKGIAWHPKWFLGYELYGKTIGIVGFGRIGQAIARRAKGFNMRILYYSRTRKSQAEKEL
    GAEYRPLEEVLKESDFVILAVPLTKETMYMINEERLKLMKPTAILVNIARGKWDTKALIKALKE
    GWIAGAGLDVFEEEPYYNEELFSLDNWLTPHIGSATFEAREAMAELVARNLIAFKRGEIPPTLV
    NKEVIKIRKPGFN EQ
    Protease 1 (P. horikoshii OT3); SEQ ID NO: 5
    MKVLFLTANEFEDVELIYPYHRLKEEGHEVYÎASFERGTTTGKHGYSVKVDLTFDKVNPEEFDAL
    VLPGGRAPERVRLNEKAVSIARKNFSEGKPVASICHGPQILISAGVLRGRKGTSYPGIKDDMIN
    AGVEWVDAEVWDGNWVSSRVPADLYAWMREFVKLLK
    Pbi Protein Majority T5 phage tail: SEQ ID No. 6
    MSLQLLRNTRIFVSTVICrGHNKJNTQEILVQDDISWGQDSNSTDITVNEAGPRPTRGSKRFN DSLN AAEWSFSTYILPYKDKIMTSKQIVPDYMLWH ALSSGRAINLEGTTGAH NN ATN FMVN FK DNSYHELAMLHIYILTDKTWSYIDSCQINQAEVNVDIEDIG! 5GNGNQLIPLDEQPFDPD QIGIDDETYMTIQGSYIKNKLnLKIKDMDTNKSYDIPITGGTFTINNNnYLTPNVMSRVnPÏG
    SFTGAFELTGSLTAYLNDKSLGSMELYKDLIKTLKWNRFEIALVLGGEYDDERPAAILVAKQAH
    VNIPnETDDVLGTSVEFKAIPSDLDAGDEGYLGFSSKYTRTTIIMNLIVNGDGATDAVTAITVKS
    AGNVTTLNRSATLQMSVEVTPSSARNKEVTWArTAGDAATINATGLLRADASKTGAVTVEATA
    KDGSGVKGTKVITVTAGG ANC80 Malate Dehydrogenase (synthetic protein): SEQ ID No. 7
    MTKVSWGAAGTVGAAAGYNLALRDIADELVFVDIPDQEDVTIGQAADTNHGVAYDSNTTVR
    QGGYEDTAGSDVWrTAGIPRQPGQTRIDLAGDNAPIMEDIGSSLAEHNDDFVTITTSNPVDL
    LNRHLYETGDRAREKVIGFGGRLDSARFRWLSQRFDAPVQNVEATILGEHGDAQVPVFSKVR
    VDGTDPEFSADEKEEILGDLQESAMDVIERKGATQWGPATGVAHMVEAVLHDTGEVLPGSW
    LDGEFGHEDTAFGVPVKLGSNGVEEWEWDLDDYEQDLMDDAAEKLSDQYDKIA
    权利要求:
    Claims (21)
    [1]
    1 - Cationic complexes formed of a lanthanide ion Ln3 + and a ligand of formula (I):

    wherein: -X ... and .Y, identical or different, each independently represent -CH2 "(CH2) n-, -CH1-CCHz ^ -ACHhCtt or -CH1-CRaRVCHr, X being read on the formula general (I) from left to right and Y reading on the general formula (I) from right to left, with; o nqui-est.gal · al, 2 or 3 ·; · .... ο-.ΓΑ which represents -NR2-, -O (CH2): ## STR2 ## wherein R 2 is an atom. of hydrogen, a methyl group or -CH2Rs, wherein Rs represents a phenyl, pyridinyl or plcotinyl group, R3 represents a methyl group, and R4 represents -NHR #, R4 represents -H, -CH3, -CH2R6 Wherein Re is phenyl or pyridinyl;

    with: .... R7 which represents -COO, <ONH2 ^ -CONHRg, -PR900, or a group selected from:

    with Rg representing a hydrogen atom, a methyl, ethyl or phenyl group; and O Re which represents a hydrogen, fluorine, chlorine, bromine or iodine atom, -OH or -NH 2 group; it being understood that at least one of X and Y is different from -CH2- (CH2) n-, and their salts with an anion, their solvates and hydrates; with the exception of the cationic complexes formed of an lanthanide ion In3 + and a ligand corresponding to one of the following formulas (1.1) to (1.5), and their salts with an anion, their solvates and hydrates:




    [2]
    2 - Complexes according to claim 1 formed with a ligand corresponding to one of the following formulas: with R 1, R 2, n and R "which are as defined in claim 1, as well as their salts with an anion, their solvates and hydrates.


    [3]
    3 - Complexes according to claim 1 or 2 in the form of a salt with an anion selected from: Ci ', Br', Γ, OH ', N03', triflate, PF6 ", SbF6 ', B (Ph) 4' , BF4 ', sulphates, carbonates, phosphates and carboxylates.
    [4]
    4 - Complexes according to one of claims 1 to 3 formed with a ligand corresponding to formula (IA):

    where n = 1 and R2 = H, and Ri is-te! as defined in claim 1, as well as their salts with an anion, their solvates and hydrates.
    [5]
    5 - Complexes according to one of claims 1 to 4 characterized in that Ri represents

    with: - R which represents -COO or -PRgOO with R9 which represents a methyl or ethyl group; or else R7 which represents a group:

    - Rs which represents a hydrogen atom, fluorine, chlorine, bromine or iodine; as well as their salts with an anion, their solvates and hydrates,
    [6]
    6 - Complexes according to claim 1, chosen from the complexes of formula:

    as well as their salts with an anion, in particular their hydrochloride salt, their solvates and hydrates,
    [7]
    7 - Complexes according to one of claims 1 to 6, with a lanthanide ion Ln3 +, Ln being Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb or Lu, with Eu, Tb, Yb and Lu which are preferred.
    [8]
    8- Use of a complex as defined in any one of claims 1 to 7, or a cationic complex formed of a lanthanide ion Ln3 + and a ligand of formula (1.1) to (1.5) such that defined in claim 1, or a salt thereof with an anion, their solvates or hydrates, as an aid to the crystallization of a biological macromolecule. S - Use according to claim 8 characterized in that the complex is used as nucleating agent and / or as crystallizing agent during the crystallization of a biological macromolecuie,
    [10]
    10 - Use according to claim 8 or 9 characterized in that, in the complex, Ln = Eu or Tb and the complex is also used as a luminescent agent for the detection of crystals.
    [11]
    11 - Use of a complex as defined in any one of claims 1 to 7, or a cationic complex formed of an lanthanide ion ln3 + and a ligand of formula (1,1) to (1.5) as defined in claim 1, or one of their salts with anton, their solvates or hydrates, as an aid in obtaining structural data of a biological macromolecuie.
    [12]
    12 - Use according to claim 11 characterized in that the complex is used as a phasing agent during the structural determination by X-ray diffraction.
    [13]
    13- Use according to claim 11 or 12, characterized in that, in the complex, the complex is also used as an aid for 'from: X-rays.
    [14]
    14 - Use according to one of claims 8 to 13 characterized in that the biological macromolecule is selected from peptides, proteins and nucleic acids, including DNA or RNA.
    [15]
    15- A crystal derived from a biological macromolecule comprising a complex according to one of claims 1 to 7 or a cationic complex formed of a lanthanide ion Ln3 + and a ligand of formula (1.1) to (1.5) as defined in claim 1, or a salt thereof with an anion, solvate or hydrate.
    [16]
    16 - Crystal derivative according to claim 15 characterized in that the biological macromolecuie is selected from peptides, proteins and nucleic acids, including DNA or RNA.
    [17]
    17. Process for crystallizing a biological macromolecule, preferably selected from peptides, proteins and nucleic acids, in particular DNA or RNA, comprising the following steps: having a solution comprising said biological macromolecule and a complex as defined in any one of claims 1 to 7, or a cationic complex formed of a lanthanide ion Ln3 * and a ligand of formula (1.1) to (1.5) such as defined in claim 1, or a salt thereof with an anion, solvate or hydrate, - obtaining crystals of the biological macromolecule from said solution.
    [18]
    18 - Crystallization method according to claim 17 characterized in that the solution further comprises a precipitating agent chosen from salts such as ammonium salts, sulphates, acetates, phosphates, citrates, formates, tartrates such as sodium or potassium tartrate, sodium and potassium double tartrate, chlorides, iodides and fluorides, for example NaCl; polymers such as polyethylene glycols and Jeffamine T; ethanol, dioxane, methylpentanediol, glycerol, isopropanol, 2-methyl-2,4-pentanedio.
    [19]
    19 - Crystallization process according to claim 17 or 18, characterized in that in the solution, the complex is present at a concentration of 1 to 100 mM, preferably at a concentration of 1 to 25 mM, and -. still more.prefered at a concentration of 10-mM ± 10%. Crystallization method according to Claim 17, 18 or 19, characterized in that the crystals are obtained by crystallization by vapor diffusion, by means of dialysis. , ··, .en,:. Batch or / still · ... in a crystallization process in cubic phase.lipids ... ...
    [21]
    21. A method of analysis or determination of the structure of a biological macrolucleotide comprising the following steps: ... have a crystal derived from the biological macromolecule as defined in claim 15 or 16, and (b) analyze the crystalline structure of the biological macromolecule at. starting from · said derivative crystal ...... ... 22 - Method.of analysis: or determination according to: la.revendication 21 characterized in that the derived crystal is obtained according to acrystallization method according to the any one of claims 17 to 20, 23 -. Analysis or determination method according to claim 21 or 22, characterized in that. you. derived crystal is obtained by soaking a crystal of ... the biological macromolecule in a solution of a complex according to any .. .. Claims 1-7 or a cationic complex formed of a lanthanide ion Ln3 + and a ligand of formula (1.1) to (1.5) as defined in claim 1, or a salt thereof with an anion, their solvates or hydrates.
    [24]
    24 - A method of analysis or determination according to claim 21 or 22 characterized in that the derived crystal is obtained by dipping a crystal derived from the biological macromolecule obtained according to a crystallization process according to any one of claims 17 to 20, in a solution of a complex according to one of claims 1 to 7 or a cationic complex formed of a lanthanide ion Ln3 + and a ligand of formula (1.1) to (1.5) as defined in claim 1, or a salt thereof with an anion, their solvates or hydrates.
    [25]
    25 - A method of analysis or determination according to any one of claims 21 to 24 characterized in that the analysis of the crystalline structure of step b) corresponds to the determination of the structure of the biological macromolecule made by diffraction X-rays (RX) or obtaining structural data by the SAXS or MASC method.
    类似技术:
    公开号 | 公开日 | 专利标题
    FR3045606A1|2017-06-23|LANTHANIDE COMPLEXES FOR CRYSTALLIZING BIOLOGICAL MACROMOLECULES AND DETERMINING THEIR CRYSTALLOGRAPHIC STRUCTURE
    US9024028B2|2015-05-05|Methods and compositions for the synthesis of multimerizing agents
    ES2619374T3|2017-06-26|Process for preparing optically active diamine derived salt
    US10590176B2|2020-03-17|Engineered programmable molecular scaffolds from porous protein crystals
    EP2486020B1|2017-08-16|Method for the synthesis of ergothioneine and the like
    US8163937B2|2012-04-24|Process for preparing |-N-[|-3-amino-1-|-2,3-dioxopropyl]-3-[|-2-[[[|amino]-carbonyl]amino]-3,3-dimethyl-1-oxobutyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide
    CN106661074A|2017-05-10|Synthesis of phosphoramidates
    JP5484041B2|2014-05-07|Protein crystallization agent and protein crystallization method using protein crystallization agent
    Moschovi et al.2015|Structure of protic | and aprotic | imidazolium ionic liquids: A vibrational spectroscopic study
    JP2011514341A|2011-05-06|Process for producing optically active α-aminoacetals
    WO1999061912A1|1999-12-02|Molecular rod and uses
    WO2018215178A2|2018-11-29|Novel metal ion complexes for the crystallisation of biological macromolecules and for determining the crystallographic structure thereof
    JP6736466B2|2020-08-05|Crystalline cyclic sodium phosphonate and method for producing the same
    Ye et al.2018|Thermo-responsive recoverable polymeric inhibitors for the resolution of racemic amino acids
    JP5230956B2|2013-07-10|Method for solubilizing hydrophobic macromolecules using quaternary ammonium salts
    RU2501786C2|2013-12-20|Method of producing n-alkyl | acrylamides
    JP5855666B2|2016-02-09|Process for producing amino acids from 2-aminobutyrolactone
    TWI525069B|2016-03-11|Method for the production of amine alkylthiosulfic acid compounds
    CN110099910A|2019-08-06|The preparation method and its eutectic of 7H- pyrrolo- [2,3-d] pyrimidine derivatives
    JP2013519676A|2013-05-30|Preparation of lamivudine Form I
    CN103097356B|2016-01-13|13-cyclohexyl-3-methoxyl group-6-[methyl-|-amino]-oxyethyl group }-ethyl)-formamyl]-7H-indoles also-[2,1-a]-preparation of [2]-benzo-aza *-10-carboxylic acid
    JPWO2017169445A1|2018-10-11|Heavy atomized compound, composition for promoting crystallization of membrane protein, and method for structural analysis of membrane protein using the composition
    WO2021005508A1|2021-01-14|Methods for producing tris|methane or salts of same
    CA3030817A1|2018-01-25|Method for the resolution of baclofen salts
    WO2021132297A1|2021-07-01|Carbacyclic phosphatidic acid compound
    同族专利:
    公开号 | 公开日
    EP3390388A1|2018-10-24|
    US20180362550A1|2018-12-20|
    EP3390388B1|2021-02-03|
    FR3045606B1|2019-04-05|
    WO2017103545A1|2017-06-22|
    US10696694B2|2020-06-30|
    引用文献:
    公开号 | 申请日 | 公开日 | 申请人 | 专利标题
    GB0110091D0|2001-04-25|2001-06-20|Imp College Innovations Ltd|Nucleation-inducing material|
    FR2896501B1|2006-01-20|2008-04-25|Commissariat Energie Atomique|NOVEL LIGANDS AND COMPLEXES OF LANTHANIDES, AND THEIR USE AS CONTRAST AGENTS|
    FR2991322B1|2012-06-05|2014-06-20|Univ Blaise Pascal Clermont Ii|COMPLEXES OF LANTHANIDES COMPRISING 1,2,3-TRIAZOLE FUNCTIONS: APPLICATIONS TO STRUCTURAL RESOLUTION OF PROTEIN ENTITIES BY X-RAY DIFFRACTION|
    FR3004189B1|2013-04-04|2015-09-04|Ecole Norm Superieure Lyon|LANTHANIDE COMPLEXES COMPRISING AT LEAST TWO BETA GROUPS, USEFUL AS LUMINESCENT MARKERS|FR3065883A1|2017-05-06|2018-11-09|Polyvalan Sas|NOVEL METAL ION COMPLEXES FOR CRYSTALLIZING BIOLOGICAL MACROMOLECULES AND DETERMINING THEIR CRYSTALLOGRAPHIC STRUCTURE|
    US20210221715A1|2018-06-01|2021-07-22|Cornell University|Metal-chelating compositions and their use in methods of removing or inhibiting barium scale|
    CN112108086A|2020-09-24|2020-12-22|上海理工大学|Directional solidification segregation device and method for colloidal particle system|
    法律状态:
    2016-10-18| PLFP| Fee payment|Year of fee payment: 2 |
    2017-06-23| PLSC| Search report ready|Effective date: 20170623 |
    2017-12-21| PLFP| Fee payment|Year of fee payment: 3 |
    2019-12-19| PLFP| Fee payment|Year of fee payment: 5 |
    2020-12-23| PLFP| Fee payment|Year of fee payment: 6 |
    优先权:
    申请号 | 申请日 | 专利标题
    FR1562880A|FR3045606B1|2015-12-18|2015-12-18|LANTHANIDE COMPLEXES FOR CRYSTALLIZING BIOLOGICAL MACROMOLECULES AND DETERMINING THEIR CRYSTALLOGRAPHIC STRUCTURE|
    FR1562880|2015-12-18|FR1562880A| FR3045606B1|2015-12-18|2015-12-18|LANTHANIDE COMPLEXES FOR CRYSTALLIZING BIOLOGICAL MACROMOLECULES AND DETERMINING THEIR CRYSTALLOGRAPHIC STRUCTURE|
    PCT/FR2016/053539| WO2017103545A1|2015-12-18|2016-12-16|Lanthanide complexes for crystallising biological macromolecules and determining the crystallographic structure thereof|
    EP16831494.6A| EP3390388B1|2015-12-18|2016-12-16|Lanthanide complexes for crystallising biological macromolecules and determining the crystallographic structure thereof|
    US16/061,691| US10696694B2|2015-12-18|2016-12-16|Lanthanide complexes for crystallising biological macromolecules and determining the crystallographic structure thereof|
    [返回顶部]